SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187919143|ref|YP_001888174.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187919143|ref|YP_001888174.1|
Domain Number 1 Region: 35-110
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.1e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187919143|ref|YP_001888174.1|
Sequence length 128
Comment hypothetical protein Bphyt_4428 [Burkholderia phytofirmans PsJN]
Sequence
MSSSDHALMPSTLPSTQNAASQFIRLAETRREPLHFFIDGQEVAALQGDTLLTAVLMQQR
RVRESEFSGAPRAGFCLIGACQDCWMRTEDGKRVRACSTPVTEGMRVLTRIAAVVTSAGA
ADENGEAR
Download sequence
Identical sequences B2TFD3
398527.Bphyt_4428 WP_012426320.1.30149 gi|187919143|ref|YP_001888174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]