SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187919227|ref|YP_001888258.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187919227|ref|YP_001888258.1|
Domain Number 1 Region: 143-298
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.06e-43
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00049
Further Details:      
 
Domain Number 2 Region: 437-587
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 1-149
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.25e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.023
Further Details:      
 
Domain Number 4 Region: 344-451
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187919227|ref|YP_001888258.1|
Sequence length 596
Comment Sulfite reductase [Burkholderia phytofirmans PsJN]
Sequence
MYQYTEFDQSFVRSRAAQFRDQLERWQSGKLSEDDFRPLRLQNGWYVQRHAPMLRVAIPY
GELSSRQLRMLARIAREYDEPEAEVYRLASEAQRKLGTVRLPTNYAHFTTRTNVQFNWIP
LSKAADVMDLLASVDMHGIQTSGNCIRNISCDERAGVAPDEIADPRPFAEIMRQWTTLHP
EFAFLPRKFKIAITGASEDRAATDWHDVGLRLLRNEAGELGFRVTVGGGMGRTPVIGTVL
REFLPWQHIMNYIEAVVRVYNQYGRRDNKYKARIKILVKAEGQRYIDGVEEEFRQIVEHD
GGPHTIPLAELERVSACFALPSRPSVDAPIDLEAIATSNAVALETPQFERWLQRNVSPHR
NQRLRIVTLSFKRLLQAPGDASAEQLDRVADLAERFSAGEARVTHTQNVVLPWVHVNDLL
PLWQAAREAGLASANVNLLTDMIACPGGDFCALANARSIPVAEAITERYQDLDELNDIGD
IDLHISGCINSCGHHHSGHIGILGVDKDGKEWYQVTLGGSDGSHASGRAQAGKVIGPSFS
AAEVPEVIDALLSAYLDIRAAVGGRRESFVETVRRAGIEPFRTAADRVRTLMEKTA
Download sequence
Identical sequences B2TGS7
398527.Bphyt_4515 WP_012426404.1.30149 gi|187919227|ref|YP_001888258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]