SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187919274|ref|YP_001888305.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187919274|ref|YP_001888305.1|
Domain Number 1 Region: 161-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-42
Family HI0933 N-terminal domain-like 0.066
Further Details:      
 
Domain Number 2 Region: 10-88
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.01e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187919274|ref|YP_001888305.1|
Sequence length 591
Comment FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Burkholderia phytofirmans PsJN]
Sequence
MNSVGVATPVSVTINGHRIDVDAGTTVAAALVLAGVRSTRMSVSGQPRAALCGMGVCQEC
RVTIDGRAHALACQTLCREGQVVRTQDTAGAQLGCTWILWSRKPVWTSRMKRWTLDDSAL
RSCRPRRRLGELGTNGRSPDETTPGYRCHGRRPGQVEPRSGHSMKQHFDIVIVGAGPAGL
NAASAAARAGATVALVDDNPRAGGQIWRQGPGHAPQAQLRSFLTAIGEQNAITHWPSTRV
VAPLSRRGLLLESTEFGGACVTYERLILATGARERLLPFAGWTLPGVTGAGALQALIKGG
MPVRGERIVIAGSGPLLIAALATARAAGARVAAVVEQASAFYVARFGVSLLAAPAKLRQA
VGMTRGFAGLRYWTGSVVEEAQGEGRVERVTVRCGREGRRVTLDCDRVACGYGLVPNITL
AQALGCAIGEAGEIVVDGKQRTSVESVFAAGECTGVGGAELAGVEGEIAGLAASGAGADH
AALDAHRARWRRFARRVDTAFALQDAARTPPADSTLLCRCEDVSIGDVRAFNDWREAKLH
TRCGMGACQGRICGTAASVYFGWQAAAPRPPFSPAQIGTLMALVAEPPPVE
Download sequence
Identical sequences B2TD21
398527.Bphyt_4562 WP_012426449.1.30149 gi|187919274|ref|YP_001888305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]