SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187919774|ref|YP_001888805.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187919774|ref|YP_001888805.1|
Domain Number 1 Region: 129-272
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.6e-35
Family Reductases 0.02
Further Details:      
 
Domain Number 2 Region: 41-139
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.32e-30
Family Ferredoxin reductase FAD-binding domain-like 0.0021
Further Details:      
 
Domain Number 3 Region: 316-413
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.51e-28
Family 2Fe-2S ferredoxin-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187919774|ref|YP_001888805.1|
Sequence length 414
Comment oxidoreductase FAD-binding domain-containing protein [Burkholderia phytofirmans PsJN]
Sequence
MRDQATFQLSPEPAPDHAASRVTQPRFWETLPPRWNSDTDDTLVCCQVRQETHDVKSFFF
RAPSGRAFVFEPGQFITLELEIDGESINRCYTISSPPTRPHTISITVKRVPGGKVSNWLH
DNLHAGAEVRVLGPSGEFTCARHPARKFLFLSAGSGITPLMSMSRAHHELGEDSDIVFVH
SARTPDDIIFARELDLIASNQAHFRTAFVCERVGARTNWPGVTGFLTLPLLKLIAPDYLE
REIFTCGPAPYMQAVRNLLDEGGFDRRHYHEESFSFETVSEVAAQLTTAHVADALQSVGA
PVTADSFVEAREEAPGFAPAPVSIETEIRFKVSFAKSNREIECGSGQHVLDAAKKAGVRL
PASCTQGMCGTCKVKLVSGEVAMKHAGGIRQREIDQGMVLLCCSKPLSDLVVDK
Download sequence
Identical sequences B2TCL1
gi|187919774|ref|YP_001888805.1| 398527.Bphyt_5071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]