SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187920067|ref|YP_001889098.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187920067|ref|YP_001889098.1|
Domain Number 1 Region: 138-314
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.92e-20
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 21-99
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.022
Further Details:      
 
Domain Number 3 Region: 278-412
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.87e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0035
Further Details:      
 
Domain Number 4 Region: 407-502
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000000011
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187920067|ref|YP_001889098.1|
Sequence length 507
Comment precorrin-3B synthase [Burkholderia phytofirmans PsJN]
Sequence
MSVLKQASPSSVLSDAAATPRPSACPGLLRIVAARDGGICRIKLPGGELSAAQARAIADA
STRHAAGVIELTNRANVQVRGVKRGEEAALIAALIDAGLGPMPVNGVASHGNTTAAENAV
NAGVASAVDAIVAPAAADDVRNVMISPAAGRDPSALFDTRPLCAELLTMLQSETRFAALS
PKFALLLDGGERLARVDHPHDVWLAASQEADGVRFVFGLAGCPPMSAHAGAFTQSQSTAS
EKPRVNDTGALAAILPSQVPALVRALLLTFLDLAAADATRMRHLLTAHSAEAILHHAQRY
LDFPLTQNAKLANWHRVIPADANLRLGAHAQRVPGTWHVGGQPPLGRLDADTLHALATLS
QQHGNATLHLTPWQSVLLPDIATHAVPVVLSGLNALGLACEPAQAITHLVACAGSSGCAR
GLADTKTDALRLAARLPAGVDVHLSGCARSCAAAHCAPYTLLAAAPGLYDFYRRDGRPGF
GQCVARQLTIDQAADMLERLVRSDTDA
Download sequence
Identical sequences B2TBT0
398527.Bphyt_5369 WP_012427236.1.30149 gi|187920067|ref|YP_001889098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]