SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187920661|ref|YP_001889693.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187920661|ref|YP_001889693.1|
Domain Number 1 Region: 146-228
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.93e-27
Family CO dehydrogenase ISP C-domain like 0.00073
Further Details:      
 
Domain Number 2 Region: 61-149
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.54e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187920661|ref|YP_001889693.1|
Sequence length 241
Comment (2Fe-2S)-binding domain-containing protein [Burkholderia phytofirmans PsJN]
Sequence
MSSHNESQDPGDVPAAIPTKPSRRRFLQSAAAAATVGAAPHLRAQTQTPTAPPAQVQQAV
PPRPVTLTVNGRAYTLQLEPRVTLLDALREYAGLMGTKKGCDRGQCGACTVLADGRRINS
CLTLAVMHEGENITTVEGLAANGVLSPIQRAFIEHDAFQCGYCTPGQLCSATALLNEFRN
GTASTVTADVRIRPAQLSDEEIRERMSGNICRCGAYANIVAAVRAVHEGGGPVSGNDNPN
A
Download sequence
Identical sequences B2T854
WP_012427830.1.30149 398527.Bphyt_5989 gi|187920661|ref|YP_001889693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]