SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187921734|ref|YP_001890766.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187921734|ref|YP_001890766.1|
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily DOPA-like 6.02e-42
Family DOPA dioxygenase-like 0.00000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187921734|ref|YP_001890766.1|
Sequence length 116
Comment Dopa 45-dioxygenase [Burkholderia phytofirmans PsJN]
Sequence
MTFRDLSAITSWHAHVYFDAGSRDAAWTFREQISAHWGDALQLGRFHERLVGPHPMWSYQ
LAFTQSQFADVVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSYELVLSALN
Download sequence
Identical sequences B2TA93
398527.Bphyt_7107 WP_012428891.1.30149 gi|187921734|ref|YP_001890766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]