SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187922971|ref|YP_001894613.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187922971|ref|YP_001894613.1|
Domain Number 1 Region: 120-287
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.03e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 409-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00051
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.41e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0065
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.2e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187922971|ref|YP_001894613.1|
Sequence length 559
Comment ferredoxin--nitrite reductase [Burkholderia phytofirmans PsJN]
Sequence
MYQYDQYDQTIVDERVAQYADQVRRRLSGELSEEEFRPLRLQNGLYYQRHAYMHRIAIPY
GNLRSDQMRVLAQIAREHDRGYGHFSTRSNIQYNWIKLEETPEILRKLAAVQMHGIQTSG
NCIRNITADQFAGVAPDEVVDPRPWAEILRQWSTFHPEFAWLPRKFKIAVSGSKEDRAAV
QIHDMGVYLRKNEQGELVADILAGGGMGRTPIIGAIIRKDLPWQHLLTYCEAVLRVYNRY
GRRDNMYKARIKILVKALSPEKFSAQVEEEWQHLKDGPSTLTQAEVDRVSQYFQPPVYEK
LADTDASFEKHLLENRAFARWVERNVRPHKVEGYSSVTLSLKPTTIAPGDATDAQMEAVA
DWADEYSLGEIRVSHEQNLILANVKKRDLFALWEKAKAQGFATPNIGLLTDIIACPGGDF
CSLANAKSIPIALAIQERFNDLDYVYDLGDVSLNISGCINACGHHHVGNIGILGVDKDGS
EWYQVTLGGEQGTGATGAHLGRVIGPSFSAEEMPDVMSKVIDTFVENRHEGERFIETYNR
IGITPFKERVYASRQPAHA
Download sequence
Identical sequences B2T132
gi|187922971|ref|YP_001894613.1| WP_012432021.1.30149 398527.Bphyt_0970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]