SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187923346|ref|YP_001894988.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187923346|ref|YP_001894988.1|
Domain Number 1 Region: 214-649
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 3.99e-98
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00013
Further Details:      
 
Domain Number 2 Region: 75-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.53e-35
Family Ferredoxin domains from multidomain proteins 0.00015
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.1e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187923346|ref|YP_001894988.1|
Sequence length 777
Comment NADH dehydrogenase subunit G [Burkholderia phytofirmans PsJN]
Sequence
MVELEIDGKKVEVPEGSMVIQAAHKVDTYIPHFCYHKKLSIAANCRMCLVDVEKMPKAVP
ACATPVSAGMIVRTKSDKAVKGQQAVMEFLLINHPLDCPICDQGGECQLQDLAVGYGKSG
SRYSEEKRVVFHKNVGPLISMEEMSRCIHCTRCVRFGQEVAGVMELGMLGRGEHSEITSF
VGKTVDSELSGNMIDLCPVGALTSKPFRYSARTWELSRRKSVSPHDSVGANLVVQVKNNR
VMRVLPFENESINECWISDKDRFSYEGLNSPERLTQPMLKQGGKWVETDWQTALEYVVKG
LKGIKGDHGANALAALGSAHSTVEELFLLKQLAQAVGTPNVDFRLRQSDFSAPVNGTPWL
GTAIADLSNVDAALVIGSDLRRDHPLFAARLRQAAKGGAKLTLVQSTNDDALIPQAERVV
AAPSAWLDALAGIAGAVSEGNGVALPEAFAGTQPTDANKKVAKSLATGERRLVLLGNSAV
RHPDFAAIHAAAQWIADATGATLGFLTEAANTVGAHLVNALPGEGGLNAREVFEQPRKGY
VLLNVEPEFDTANPAQALAALKQAEMVVVMSPFQTGAEYADVLLPIAPYTETAGTFVNAE
GTVQTFNGVVRPLGDTRPAWKVLRVLGSLLGLPGFEFDTSEEVRTAALGDGELNSRLSNK
TSATVARGKAAKAAEGKFERLANVPIYHADALVRRAESLHLTAAARAANSVGLPAGLFDK
LGLKEGDAVRVRQGEQSVQLPAVRDANLAETVVRVSAATPAGAALGSLFGELVVEKA
Download sequence
Identical sequences B2T2F3
398527.Bphyt_1349 WP_012432381.1.30149 gi|187923346|ref|YP_001894988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]