SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187923882|ref|YP_001895524.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187923882|ref|YP_001895524.1|
Domain Number 1 Region: 24-103
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187923882|ref|YP_001895524.1|
Sequence length 126
Comment hypothetical protein Bphyt_1892 [Burkholderia phytofirmans PsJN]
Sequence
MTTQSTHSLFKPLPGAQGAAATQVAIWFNDRPLSVPAGCSVAAALLAAGVSRFRATPVSG
APRAPFCMMGACFDCLVEIDGMPSRQACMVEVTAGMRIRSQEGARDLPPCGATDLNNASL
ESAHDR
Download sequence
Identical sequences B2T3Y9
WP_012432902.1.30149 398527.Bphyt_1892 gi|187923882|ref|YP_001895524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]