SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187924551|ref|YP_001896193.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187924551|ref|YP_001896193.1|
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.42e-29
Family 2Fe-2S ferredoxin-related 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187924551|ref|YP_001896193.1|
Sequence length 113
Comment 2Fe-2S type ferredoxin [Burkholderia phytofirmans PsJN]
Sequence
MPQIVVLPHVELCPEGAVIDAVPGKSICDNLLEHGIEIEHACEKSCACTTCHVIVREGFA
ALTPSEEDEDDLLDKAWGLEPASRLSCQAMVPAEQDLVVEIPRYSINHAKENH
Download sequence
Identical sequences A0A0N0ZDZ3 A0A1I7AG86 B2SXW0
WP_012433562.1.22769 WP_012433562.1.30149 398527.Bphyt_2574 gi|187924551|ref|YP_001896193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]