SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187925112|ref|YP_001896754.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187925112|ref|YP_001896754.1|
Domain Number 1 Region: 200-334
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.01e-39
Family Reductases 0.0032
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-25
Family 2Fe-2S ferredoxin-related 0.043
Further Details:      
 
Domain Number 3 Region: 102-199
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.11e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187925112|ref|YP_001896754.1|
Sequence length 343
Comment CDP-6-deoxy-delta-3,4-glucoseen reductase [Burkholderia phytofirmans PsJN]
Sequence
MAFNVTLRQSGRQFQVEQDEPVLSAALRQGIGLPYGCKNGACGSCKGTVVSGEIEQRAHS
SSALSNDEKTRGMALFCCATACTDLEVDIREVAGVGDVQVKKLPCRVNAIERKADDVVVL
KLQLPANERLQYLAGQYLEFILKDGKRRSYSMANAPHTEGPIELHIRHMPGGAFTDHVFN
TMKERDILRFEAPLGTFFLREDSDKPIVLLASGTGFAPLKAIVEHAVFKNLNRPMTLYWG
ARRKKDLYLLELAEQWAREIPNFKFLPVLSEPDAGDAWTGRVGFVHRAVIEDLPDLSAYQ
VYACGAPVMVESAQRDFTQHHGLPEDEFYADSFTSAADLANAV
Download sequence
Identical sequences B2T6G6
398527.Bphyt_3138 gi|187925112|ref|YP_001896754.1| WP_012434103.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]