SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187925515|ref|YP_001897157.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187925515|ref|YP_001897157.1|
Domain Number 1 Region: 16-287
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.88e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000171
Further Details:      
 
Domain Number 2 Region: 288-312,358-443
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.38e-22
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187925515|ref|YP_001897157.1|
Sequence length 459
Comment cytochrome b/b6 domain [Burkholderia phytofirmans PsJN]
Sequence
MAIEHEVETTGLVGWIDRRFPLTSTWKKHVSEYYAPKNFNFWYFFGSLALLVLVNQIVTG
IFLTMNYKPDATLAFSSVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLMYGSYR
KPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFIGPDLSLWIRG
DYVVSDVTLNRFFAFHVIAIPLVLIGLVVAHLVALHEVGSNNPDGIEIKAKKDPDGIPID
GIPFHPYYSVHDFMGVSVFLLIFAAIIFFAPEMGGYFLEANNFVPANPLQTPPEIAPVWY
FTAFYAMLRATTDPFKIVLMVIIGLLGLLALVRARGKWKLGLPVLAVLVILAMAFTESKF
WGVVVMGSAVVSLFFLPWLDRSPVKSIRYRPFFHKVFYGIFVLVFLTLAFLGTKPPSPTA
TLIAQVCALIYFAFFLGMPFWTRLGTFKQPPERVRFKPH
Download sequence
Identical sequences B2SZ48
WP_012434492.1.30149 398527.Bphyt_3543 gi|187925515|ref|YP_001897157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]