SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187925576|ref|YP_001897218.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187925576|ref|YP_001897218.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.53e-34
Family Frataxin-like 0.0000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187925576|ref|YP_001897218.1|
Sequence length 105
Comment frataxin-like protein [Burkholderia phytofirmans PsJN]
Sequence
MSDSEYLTRAEAALAAIERALDDTDADIELERSGNVLTLEFENRTKIIVNLQPPMSEIWI
AAKAGGFHFRFVDGEWRDTRSGTEFFAALSEYATQQAGEPVHFKA
Download sequence
Identical sequences B2T711
398527.Bphyt_3604 WP_012434552.1.30149 gi|187925576|ref|YP_001897218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]