SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187925856|ref|YP_001897498.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187925856|ref|YP_001897498.1|
Domain Number 1 Region: 641-1099
Classification Level Classification E-value
Superfamily ALDH-like 1.11e-126
Family ALDH-like 0.000000336
Further Details:      
 
Domain Number 2 Region: 259-607
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.49e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000574
Further Details:      
 
Domain Number 3 Region: 89-258
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 7.32e-64
Family N-terminal domain of bifunctional PutA protein 0.000000441
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000823
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Domain Number 5 Region: 1144-1268
Classification Level Classification E-value
Superfamily ALDH-like 0.0000772
Family ALDH-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187925856|ref|YP_001897498.1|
Sequence length 1309
Comment multifunctional functional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia phytofirmans PsJN]
Sequence
MASTTLGVKVDDLLRSRLKDAATRLERTPHWLIKQAIFAYLEKIEHGQLPPELSGVTGSA
DLADGASVEQEEDGASHPFLEFAQNVQPQSVLRAAITAAYRRPEPECLPFLVGQARLPAN
LAGDVQTMAGKLVETLRTKSKGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWKSHMGQAPSMFVNAATWGLMITGKLVTTNSETSLSSALTRLIGKGGEPL
IRKGVDMAMRLMGEQFVTGENISEALANSRKYEARGFRYSYDMLGEAATTEADAQRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMSELLPRVRSLAILARRY
DIGLNIDAEEADRLEISLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYIIDLARR
SRHRIMVRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLSAPDAVYPQ
FATHNAHTLSAIYHLAGNNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADENVAIKDLIADPVDEASKIVPLGAPHAKIPLPRN
LYGAERLNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLEDNEIAVGVARDVRNPADH
RDLVGTVVEATPEHVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLVV
REAGKSLANAVAEIREAIDFLRYYSTQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRILREAGVPAGAVQLLPGNGETVGAALVADPRTR
AVMFTGSTEVARLINKTLSGRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSS
FDSAGQRCSALRVLCLQDDVADRTLEMLTGAMRELAVGNPDRLSIDVGPVIDLDAKRGID
AHVATMREKGRKVEQLPMPDGCAQGTFVPPTLIELDSIDELKREVFGPVLHVVRYRRSQL
DKLLEQIRTTGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPAGLPKSLAQALVADAPNAAENSDNPSAALTAYRDWLIAEQ
QPVLAARCDGYLSHMPAGATAVLSGPTGERNTYTLGPRGTVLCIASTASGARVQFAAALA
TGNRALFEGAAGEQLVAQLPASLKSRASVKKSADATFDAVLFEGDSDELLALVKEVAKRP
GPIVSVQGVAARALESGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences B2T7J3
gi|187925856|ref|YP_001897498.1| 398527.Bphyt_3887 WP_012434794.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]