SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187924997|ref|YP_001896639.1| from Burkholderia phytofirmans PsJN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187924997|ref|YP_001896639.1|
Domain Number 1 Region: 267-795
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.7e-191
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000211
Further Details:      
 
Domain Number 2 Region: 806-947
Classification Level Classification E-value
Superfamily ADC-like 1.51e-40
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 122-259
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.95e-38
Family Ferredoxin domains from multidomain proteins 0.0035
Further Details:      
 
Domain Number 4 Region: 49-121
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.99e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187924997|ref|YP_001896639.1|
Sequence length 982
Comment formate dehydrogenase subunit alpha [Burkholderia phytofirmans PsJN]
Sequence
MSDVLNSPTGGCGSGNCACKSQAQQQRAPRSFFDDTDFGTPERHADIDITLEIDGQSVTV
PAGTSVMRAAVEAGVNVPKLCATDSLEPFGSCRLCLVEIEGKRGYPASCTTPVEAGMKVR
TQTDRLQSLRRNVMELYISDHPLDCLTCPANGDCELQDMAGVTGLREVRYGFDGANHLKD
KKDESNPYFTYDASKCIVCNRCVRACEETQGTFALTIAGRGFESRVAASENVPFMESECV
SCGACVAACPTATLQEKTVIMLGQAEHSVVTTCAYCGVGCSFKAEMKGNEVVRMVPHKNG
QANEGHACVKGRFAWGYATHKDRITKPMIRAKITDPWREVSWEEALTYAASEFRRIQAKH
GRDSIGGITSSRCTNEETYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKTTLGESAGTQ
TFASVDKADVIMVIGANPTDGHPVFGSRLKRRVREGAKLIVVDPRRIDIVDTPHVKASHH
LQLRPGTNVAVVNALAHVIVTEGLVNEAFVAERCETRAFEQWRDFVALPENAPEATEAVT
GVPAQFVREAARIYATGGNAAIYYGLGVTEHAQGSTMVMGIANLAMATGNIGREGVGVNP
LRGQNNVQGSCDMGSFPHELPGYRHISDTVTRTLFEDAWNVTLQPEPGLRIPNMFDAAVH
GTFKGLYCQGEDIVQSDPNTHHVSAALSSMECIVVQDIFLNETAKYAHVLLPGSSFLEKD
GTFTNAERRISRVRKVMPPVPGYADWEVTVMLSRALGYEMDYTHPSQIMDEIARLTPTFH
GVSYKKLDEMGSIQWPCNEDAPDGTPTMHIDSFVRGKGKFVITKFIATPEKVTRKFPMLL
TTGRILSQYNVGAQTRRTENSRWHDEDRLEIHPHDAEERGIKTDDWVGIESRAGQTVLRA
KVTERMQPGVVYTTFHFPESGANVITTDSSDWATNCPEYKVTAVQVMPVEQPSQWQKEYS
RFNTEQLDLLKQRELANATSGK
Download sequence
Identical sequences B2T651
WP_012433994.1.30149 gi|187924997|ref|YP_001896639.1| 398527.Bphyt_3023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]