SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184153223|ref|YP_001841564.1| from Lactobacillus reuteri JCM 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184153223|ref|YP_001841564.1|
Domain Number 1 Region: 207-600
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.8e-84
Family beta-Lactamase/D-ala carboxypeptidase 0.00000243
Further Details:      
 
Domain Number 2 Region: 64-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.68e-43
Family Penicillin binding protein dimerisation domain 0.0000328
Further Details:      
 
Domain Number 3 Region: 603-658
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000249
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.004
Further Details:      
 
Domain Number 4 Region: 661-714
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|184153223|ref|YP_001841564.1|
Sequence length 719
Comment cell division protein FtsI/penicillin-binding protein 2 [Lactobacillus reuteri JCM 1112]
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDGKPLYVKDRKKTAKVLS
QYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSTMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTGINGLRKDKQDVYGYQIAN
SKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWTMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKVK
PKVVGQPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRIAGKTATAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATKQIASVFNPTMKMLLSQQKVAEKAK
KKVITMPNVVGQASDEANKELSGKGMQVIVVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDISGWSSADVQQLAKVLKLKVKENGNGYVTQQSISPDTTIKRGTTLTVQYEAKN
Download sequence
Identical sequences A0A1B7LRE7 A5VJ30 C0Z0P7
gi|184153223|ref|YP_001841564.1| WP_003668326.1.2821 WP_003668326.1.3665 WP_003668326.1.48856 WP_003668326.1.8717 WP_003668326.1.97761 WP_003668326.1.9821 WP_003668326.1.9859 557433.LAR_0568 557436.Lreu_0587 gi|148543821|ref|YP_001271191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]