SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184152839|ref|YP_001841180.1| from Lactobacillus reuteri JCM 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184152839|ref|YP_001841180.1|
Domain Number 1 Region: 37-281
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.72e-74
Family Phosphate binding protein-like 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|184152839|ref|YP_001841180.1|
Sequence length 283
Comment hypothetical protein LAR_0184 [Lactobacillus reuteri JCM 1112]
Sequence
MKRKKRRNIIIWSVVALIVVIAGYFSFIRPQQQAKRTVTVGIMAGSKQDDEIWNSVSKTA
KDKYNVTLKFKRFTDYNQPNKALENGDVDLNAFQHKLFLQTWNKAHKTDLVSLGDTFITP
IRLYSKQYKSVKEIPNGGTIAVPNDASNESRALFALKNAGLIDLKKGTKLATVSSISKNP
RDLKIKELAADQTARSLDNVDASVVNTNYAQAAGLNYKSAIFVEPVNRDSKQWVNIIAVK
GSEKNNKIYKDVVRAYQTEKTKREIKKLYGTAEIPAWDLNFNK
Download sequence
Identical sequences A0A1B7LRJ0 A5VHY9 C0YXL9
WP_003667165.1.2821 WP_003667165.1.3665 WP_003667165.1.48856 WP_003667165.1.8717 WP_003667165.1.97761 WP_003667165.1.9821 WP_003667165.1.9859 gi|184152839|ref|YP_001841180.1| gi|148543430|ref|YP_001270800.1| 557433.LAR_0184 557436.Lreu_0193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]