SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184153799|ref|YP_001842140.1| from Lactobacillus reuteri JCM 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184153799|ref|YP_001842140.1|
Domain Number 1 Region: 316-677
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.43e-58
Family beta-Lactamase/D-ala carboxypeptidase 0.011
Further Details:      
 
Domain Number 2 Region: 61-123,185-314
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.79e-28
Family Penicillin binding protein dimerisation domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|184153799|ref|YP_001842140.1|
Sequence length 685
Comment penicillin binding protein 2B [Lactobacillus reuteri JCM 1112]
Sequence
MNLFGSRTKKRQNAQSIIPFRLNMLLWIVGILLLALTIRLFYLQVLQGTSFKAEVKRSDT
TTQTNNVQRGMIYDSQGNVLVGNQTHQAITYTKGANVTTDQLYQIANRLGKYVSVSNKNS
RLTDRNEEDYYLADKERLKSVLKHVKTSDADSEDTKYDKALEYLSKHPDSWELTDQQKNN
ARIYAAMSGAYSLSTTYIKETGVSAKELAAVGEHLNEMPGVKIGTSWTRNYPQGTDIQSL
TGTVSTTGLPSDEVNSLLAQGYSRNDSVGQSYLEKQFQSTLAGSKSQTEVTTDGNDVTKE
KTKYPGKKGDNLVLTINSKFQKQVQSILKNNYSAAGNQYSTGVYAVVMNPNTGAIYAMAG
IDRNPETGKETPDEIGAINHPITMGSVVKPAMVMGALMDGVITPTNNTLTDMPIKLAGTS
SKGSWFNHGGSANMAINAATALEVSSNSYMMQLLMKEAGMKYTPNAQITMKPSIFAKARG
YFNMFGLGVKTGIDLPGETSGYTGPADQKHIGSALDLSYGNYDGYTLIQLAQYMSTIANG
GNRMRPYIVKEIRGTKANGQLGAVEYTTKPQVQLTIPASKADFDVVKQGLYQVVHGSNRY
VTGKPLASVKPSVSGKTGTAETYYKSHSTTTLSFAGFAPSDNPQVVVALAIPGASNSDGG
ANLTMAKQIFEAYWKTVQSPKGFGD
Download sequence
Identical sequences 557433.LAR_1144 gi|184153799|ref|YP_001842140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]