SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384043303|ref|YP_005482047.1| from Acetobacter pasteurianus IFO 3283-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384043303|ref|YP_005482047.1|
Domain Number 1 Region: 12-226
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.02e-68
Family "Hypothetical" protein ybl036c 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384043303|ref|YP_005482047.1|
Sequence length 232
Comment hypothetical protein APA12_23230 [Acetobacter pasteurianus IFO 3283-12]
Sequence
METPSTLPSSVLADRLAAVRQNIDASAHAAGRDPASVTLVAVSKFHPLESVQEALAAGQR
VFGENRVQEAASKFPALRATYPDLRLHLIGGLQTNKARDAVRIADVIESLDRPELAEALL
KAADKEGRLPELLIEVNTGDEPQKFGVPREKADSFIRTCRQQFGDKLQGLMCIPPAMQDP
VPHFRLLRSMAQEHGLPVISMGMSADYPQAIAEGATLVRVGTAIFGPRPPSP
Download sequence
Identical sequences C7JF47
gi|384060803|ref|YP_005499931.1| gi|384043303|ref|YP_005482047.1| gi|384064095|ref|YP_005484737.1| gi|384058162|ref|YP_005490829.1| gi|384054927|ref|YP_005488021.1| gi|384051820|ref|YP_005478883.1| WP_014457456.1.36695 WP_014457456.1.38618 WP_014457456.1.45580 WP_014457456.1.55019 WP_014457456.1.65311 WP_014457456.1.71918 WP_014457456.1.88241 WP_014457456.1.96488 WP_014457456.1.99323 634452.APA01_23230 gi|258543383|ref|YP_003188816.1| gi|384120106|ref|YP_005502730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]