SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384055923|ref|YP_005488590.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384055923|ref|YP_005488590.1|
Domain Number 1 Region: 23-420
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.15e-103
Family GABA-aminotransferase-like 0.000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384055923|ref|YP_005488590.1|
Sequence length 435
Comment 5-aminolevulinate synthase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MPRPFLTRSEEKISVGAIKNARHPFYDHCHQALDQIKHQGRYRTFTPLARQAERFPLYEE
AVRDLPQGREVIVWSTNDYLGMGVVPEVQDAAIAAIREHGAGAGGTRNIAGTSPLHTQLE
AELASLHGKEAGLLFISGYVSNQASLQTILTSMPGWICFSDRLNHASMIAGIKGARGSQT
VIYEHNDLKDLEEKLAAAPKDAPKLIAFESVYSMDGDISDIAGTCALARKYNALTYLDEV
HAVGLYGQEGGGVSQRDGVADQVDIIEGTLAKGFGVHGGYITASAEIVDFLRSTASGFIF
TTALPPPVVAGALASVRKVRAENWRRESIFERVNTFRHRLRAAGVPFTMTPSHIVPIPIG
DAERCKRICRRLLTEYGHYATPINYPTVPQGTERLRLTPGPFHTDEMMDDLINALGVLLR
EEGIMPARQAACSAA
Download sequence
Identical sequences C7JAS2 S6CXP1
gi|384041066|ref|YP_005479810.1| gi|384049581|ref|YP_005476644.1| gi|258541145|ref|YP_003186578.1| gi|529231508|ref|YP_008392323.1| 634452.APA01_00410 gi|384117934|ref|YP_005500558.1| WP_012812273.1.36695 WP_012812273.1.37930 WP_012812273.1.38618 WP_012812273.1.45580 WP_012812273.1.55019 WP_012812273.1.62313 WP_012812273.1.64431 WP_012812273.1.65311 WP_012812273.1.71918 WP_012812273.1.88241 WP_012812273.1.96488 WP_012812273.1.99323 gi|384052691|ref|YP_005485785.1| gi|384055923|ref|YP_005488590.1| gi|384061858|ref|YP_005482500.1| gi|384058564|ref|YP_005497692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]