SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384055984|ref|YP_005488651.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384055984|ref|YP_005488651.1|
Domain Number 1 Region: 21-377
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.21e-95
Family GABA-aminotransferase-like 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384055984|ref|YP_005488651.1|
Sequence length 378
Comment pleiotropic regulatory protein DegT/DnrJ/EryC1/StrS [Acetobacter pasteurianus IFO 3283-22]
Sequence
MNGSQNRPIAFLDLAAQQKRLEPALRQRLETVLAHCRFVMGPEVLELEQRLAQWCGAREC
VGVSSGTDALQIVMMGEQIGRGDAVFLPAFTYTATAEVPLVLGATPVFVDVDPNTFQIDP
EHLRSRIRAVREAGKLKPRAIVGVDLFGQPAPWADLRAIAQEEDLFLLADCAQSFGAKLN
GAPLGREATATTLSFFPSKPLGGYGDGGAILTDDPERAALYRSLRTHGEGTTRYEVLRTG
MNGRLDTLQAAVLLAKLDDFARELTRREEIACQYDAGLKDVVQVPARVPDSQSAWAIYSV
LLKNSAEREQMQARLKEQGVPSAIYYPLPLHKQPAYRDHHDGTALPVSEDLAQRILALPI
HPELTDEEVARVIAAVRG
Download sequence
Identical sequences C7JAY3 S6DB23
gi|384117995|ref|YP_005500619.1| WP_004449204.1.36695 WP_004449204.1.37930 WP_004449204.1.38618 WP_004449204.1.45580 WP_004449204.1.55019 WP_004449204.1.62313 WP_004449204.1.64431 WP_004449204.1.65311 WP_004449204.1.71918 WP_004449204.1.88241 WP_004449204.1.96488 WP_004449204.1.99323 gi|384061919|ref|YP_005482561.1| gi|384049642|ref|YP_005476705.1| 634452.APA01_01020 gi|384052752|ref|YP_005485846.1| gi|529231570|ref|YP_008392385.1| gi|258541206|ref|YP_003186639.1| gi|384041127|ref|YP_005479871.1| gi|384058625|ref|YP_005497753.1| gi|384055984|ref|YP_005488651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]