SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384056966|ref|YP_005489633.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384056966|ref|YP_005489633.1|
Domain Number 1 Region: 20-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.38e-117
Family GABA-aminotransferase-like 0.00000000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384056966|ref|YP_005489633.1|
Sequence length 432
Comment adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MGKHSMTEASGSSLSSMPEWYTQGLPHIWLPYSQMKTASAPLAAAHTHNTRITLTDGREL
VDGVAAWWTACHGYNHPHIRQAVCQQMETMPHVMFGGMVHEPALRLASRLCAMLPGDLER
VFFTDSGSVSVEVAMKMAIQYRLNKEQNKRTKMLAFRGGYHGDTLATMSVCDPEEGMHHL
YGAALMEHVISPLPVDEASTAIFLDLLAKHAHELAAIITEPLVQGAGGMLFHSPQTLRTL
RKAADDHDVLLILDEIFTGFGRTGTMFACQQAGIVPDIITLSKALTGGTMALAATVARRH
VFEAFLADNPEHALMHGPTFMANPLACACANASLDLFETEPRLQQVQDINTFLTEALEPC
RTLPGVKDVRTLGAIGVVELEKINNPDALRQRFIAEGVWIRPFRNIVYLTPAFTIEKQDL
RKLTDAIYKVLS
Download sequence
Identical sequences C7JGN0 S6CZA3
gi|384056966|ref|YP_005489633.1| WP_003623008.1.36695 WP_003623008.1.37930 WP_003623008.1.38618 WP_003623008.1.45580 WP_003623008.1.55019 WP_003623008.1.62313 WP_003623008.1.64431 WP_003623008.1.65311 WP_003623008.1.71918 WP_003623008.1.88241 WP_003623008.1.96488 WP_003623008.1.99323 gi|384053732|ref|YP_005486826.1| gi|258542186|ref|YP_003187619.1| gi|529232548|ref|YP_008393363.1| gi|384050624|ref|YP_005477687.1| gi|384062899|ref|YP_005483541.1| gi|384042107|ref|YP_005480851.1| gi|384118975|ref|YP_005501599.1| gi|384059607|ref|YP_005498735.1| 634452.APA01_10900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]