SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384056967|ref|YP_005489634.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384056967|ref|YP_005489634.1|
Domain Number 1 Region: 5-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.18e-92
Family GABA-aminotransferase-like 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384056967|ref|YP_005489634.1|
Sequence length 393
Comment 8-amino-7-oxononanoate synthase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MTRFDNLFQKGLADLSAQGRLRTCQQWQYAGGALLKRSDGVVVTDFSSNDYLGLRMHPLL
RKRAYVWAQAEGSGSGASRLVTGTSSQACVLEKRVARLKHMQAARLFSSGWQANASLVPA
LARLSAQVCGAPAVILADKLIHASLYHGCAAAGIRPIRFRHNDVAHLESLLQKTEGAGLR
IVLTESVFSMDGDVADIAALHEVTQKHDALLCVDEAHATGILGPEGAGLANGLADVVIGT
FSKALGSMGAFIAASEGLCRWLDNAASGFIYSTAPSPLVLGAVDAALDLLPQMDAQRAHV
AALATSFRQKMHDAGQDTGPSSTQIVPILVGQEAQARTLAQKMQEAGFLAVAIRPPTVPP
GGCRLRVVFHANHTWAQMEALADTFIRASKGLA
Download sequence
Identical sequences C7JGN1 S6D833
gi|384062900|ref|YP_005483542.1| gi|258542187|ref|YP_003187620.1| WP_003623010.1.36695 WP_003623010.1.37930 WP_003623010.1.38618 WP_003623010.1.45580 WP_003623010.1.55019 WP_003623010.1.62313 WP_003623010.1.64431 WP_003623010.1.65311 WP_003623010.1.71918 WP_003623010.1.88241 WP_003623010.1.96488 WP_003623010.1.99323 gi|384042108|ref|YP_005480852.1| gi|384056967|ref|YP_005489634.1| gi|384053733|ref|YP_005486827.1| gi|529232549|ref|YP_008393364.1| gi|384050625|ref|YP_005477688.1| gi|384118976|ref|YP_005501600.1| 634452.APA01_10910 gi|384059608|ref|YP_005498736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]