SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057067|ref|YP_005489734.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057067|ref|YP_005489734.1|
Domain Number 1 Region: 41-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.09e-86
Family Cystathionine synthase-like 0.000000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384057067|ref|YP_005489734.1|
Sequence length 402
Comment cystathionine beta-lyase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MTDENKVSAGWLKLASSLSHVARPQATEAGTYVNLPLERGSTVVFPSLDAMQQTGRKRYD
HVSIYGAMGSPTQHELEKAIATIEGGTDTQVVCSGLAACTTPLLAFLKAGDHCLLADNVY
GPTRRFAENMLKRFGVEISYFPPCADAATITALMRPNTRVVFTESPGSHTFEVQDVAMLA
EIAHAHGALLFFDNTWGFGVFAPFKHGVDVSIQALTKYPAGHSDVIAGAVTVADTRLWHT
LRDAAIQMGQVAGPDECWLTLRGLRSMGVRLAQQAKSALHIAKWLQTRPEVARVLHPALP
ECPGHTYWKRDFTGAGSLFGVVLKADYTVQDMQRMIDALKMYGIGASWGGYESLILPTTG
GITRSSESPVQNGPAFRLQIGLENPDDLIADLEQGLQVLKSA
Download sequence
Identical sequences C7JH86
gi|384119076|ref|YP_005501700.1| gi|384042208|ref|YP_005480952.1| gi|384057067|ref|YP_005489734.1| gi|258542287|ref|YP_003187720.1| gi|384053833|ref|YP_005486927.1| gi|384063000|ref|YP_005483642.1| 634452.APA01_11930 gi|384050725|ref|YP_005477788.1| gi|384059708|ref|YP_005498836.1| WP_012812891.1.36695 WP_012812891.1.38618 WP_012812891.1.45580 WP_012812891.1.55019 WP_012812891.1.65311 WP_012812891.1.71918 WP_012812891.1.88241 WP_012812891.1.96488 WP_012812891.1.99323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]