SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057157|ref|YP_005489824.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057157|ref|YP_005489824.1|
Domain Number 1 Region: 17-394
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.47e-93
Family Cystathionine synthase-like 0.000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384057157|ref|YP_005489824.1|
Sequence length 413
Comment serine--pyruvate aminotransferase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MEQTRMISPMFKQIDPPQRFLMGPGPINAHPRVLRAMSADMLGQFDPEMTEYMNETMALY
RQVFMTENQWTFLVDGTARAGIEAALVSLVEPGAKILIVRAGRFGLLLSEIAERIGAEIC
TLDLPWGEVASLEQIEAALQEHKPQVLACIHGDTSTTMAQPLDGVGALCKKYNVLSYVDV
TATLGGVPVCTDQWGIDVISGGLQKCMGGPPGSAPITISDRAAEHIMARRHVEAGIRSAS
LTDGQRPRIPSNYFDLAMVMDYWSEKRLNHHTEATTMLYGAREAACIVLEEGLENRFARH
KTASTALIAGLRAMGLTIFGDDAHRMANVTGVWIPASVDGDKVRMRMRDDFGIEIGTAFG
PLTGKIWRIGTMGYNAVKHKVLLTLGALEAALAAEGFKPPRGAAVDAAMASWP
Download sequence
Identical sequences C7JHH6
634452.APA01_12840 gi|384053923|ref|YP_005487017.1| gi|384050815|ref|YP_005477878.1| gi|384119166|ref|YP_005501790.1| gi|384059798|ref|YP_005498926.1| gi|258542377|ref|YP_003187810.1| WP_012812934.1.36695 WP_012812934.1.45580 WP_012812934.1.55019 WP_012812934.1.65311 WP_012812934.1.71918 WP_012812934.1.88241 WP_012812934.1.96488 WP_012812934.1.99323 gi|384063090|ref|YP_005483732.1| gi|384042298|ref|YP_005481042.1| gi|384057157|ref|YP_005489824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]