SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057515|ref|YP_005490182.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057515|ref|YP_005490182.1|
Domain Number 1 Region: 13-411
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.38e-120
Family Cystathionine synthase-like 0.0000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384057515|ref|YP_005490182.1|
Sequence length 415
Comment cysteine desulfurase SufS [Acetobacter pasteurianus IFO 3283-22]
Sequence
MSHPSITDTSGLDVAAIRKQFPILSEKVHDRPLVFLDSAASAQKPDAVINAMVHTMHHQY
ANIHRGLYWLSERATEAYEAVRDQVAGFLNAPSREEIVFTRNSTEAINLVAYSFGSLLRP
GQAVVISEMEHHANLVPWQMLRDRMGIELRIAPITDAGDLDLEAFGQLLSDGKVALVAIT
HMSNVLGTITPARQIADMAHAAGALVLFDGSQAVVHHRTDVQALGADFYTFTGHKLYGPT
GIGVLWARRALLEDMPPFMGGGDMISTVTFEKSTWANVPHKFEAGTPAIVEAIGLGAAIE
WVEKFGFDAIAAHEQALTSYALQRLATVPGLNVVGQPKERGGVISFTMADVHPHDIATLL
DRNGIAVRAGHHCAEPLMRRLGLTATARASFGIYTLQEEIDVLADTLVRIREFFV
Download sequence
Identical sequences C7JBP4
gi|384060156|ref|YP_005499284.1| gi|384119458|ref|YP_005502082.1| gi|384063448|ref|YP_005484090.1| gi|258542735|ref|YP_003188168.1| 634452.APA01_16590 gi|384051173|ref|YP_005478236.1| gi|384057515|ref|YP_005490182.1| gi|384042656|ref|YP_005481400.1| WP_014456958.1.36695 WP_014456958.1.38618 WP_014456958.1.45580 WP_014456958.1.55019 WP_014456958.1.65311 WP_014456958.1.71918 WP_014456958.1.88241 WP_014456958.1.96488 WP_014456958.1.99323 gi|384054281|ref|YP_005487375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]