SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057692|ref|YP_005490359.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057692|ref|YP_005490359.1|
Domain Number 1 Region: 36-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-117
Family Cystathionine synthase-like 0.0000000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384057692|ref|YP_005490359.1|
Sequence length 402
Comment O-succinylhomoserine sulfhydrylase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MSDNKIAFSEAWRPATRQLHAGVERTEYGETSEAVFLTSGFVYDNAEQAARTFRGEEEHY
QYSRFGNPTVAALERRLADLEGAEACVATATGMGAVSSALLSHVKAGDRVVASRALFGSC
HWIVANLLPRYGVETVFVDGCNPDEWAKALSQPTAAVLLESPSNPMLDILDIKAISDLAH
KAGAIVVVDNVFASPVFQKPLQLGADVVVYSCTKHIDGQGRVLGGAVLGRKDWITETLQP
FTRNTGNALSPFNAWVMLKGLETLSLRVNAMAANAAAVADYLASAPGIVSVRYPGRADHP
QYELAKRQMSGSGSLIAFEVKGGQKGAFAFMDALKLIAISNNLGDARSLVTHPATTTHSK
VSAEDRAVLGITDGAIRFSVGLEDSADLIDDLARGVAALQAI
Download sequence
Identical sequences C7JCD6 S6DA45
634452.APA01_18390 WP_003624541.1.36695 WP_003624541.1.37930 WP_003624541.1.38618 WP_003624541.1.45580 WP_003624541.1.55019 WP_003624541.1.62313 WP_003624541.1.64431 WP_003624541.1.65311 WP_003624541.1.71918 WP_003624541.1.88241 WP_003624541.1.96488 WP_003624541.1.99323 gi|384051350|ref|YP_005478413.1| gi|384063624|ref|YP_005484266.1| gi|529230765|ref|YP_008391580.1| gi|384060333|ref|YP_005499461.1| gi|384119634|ref|YP_005502258.1| gi|384054457|ref|YP_005487551.1| gi|384057692|ref|YP_005490359.1| gi|384042832|ref|YP_005481576.1| gi|258542911|ref|YP_003188344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]