SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057788|ref|YP_005490455.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057788|ref|YP_005490455.1|
Domain Number 1 Region: 6-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.5e-181
Family GABA-aminotransferase-like 0.000000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384057788|ref|YP_005490455.1|
Sequence length 430
Comment serine hydroxymethyl transferase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MSHTDLDRFFHASLAQTDPDVAAAIEGELKRQQEGIELIASENMASEAVLQAQGSVLTNK
YAEGYPGRRYYGGCVEVDKVENLAIDRVKTLFGAAFANVQPHSGANANQAAFMAMGKPGD
TVLGMSLAAGGHLTHGAAPNYSGKWFNSVQYGVRQQDGMLDYEEMERLAREHKPSIIVAG
GSAYPRIIDFARFRRIADEVGAFLMVDMAHFAGLVAAGLYPNPLEYAHIVTSTTHKTLRG
PRGGLILTNDEALAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALRPEFKEYQKAVQKNA
AVLAEVLVERGFDIVTGGTDSHLLLVDLRPKKVTGKAAEQALERAGITANKNAIPFDPEK
PAITSGVRLGSPAATARGFREEEFRQIGEMIDEVLTALAASSGEGNSEVENAVHERVKAL
CAKFPIYSRA
Download sequence
Identical sequences C7JD49
gi|384063721|ref|YP_005484363.1| gi|384060429|ref|YP_005499557.1| gi|384042929|ref|YP_005481673.1| gi|384057788|ref|YP_005490455.1| gi|384051446|ref|YP_005478509.1| gi|258543007|ref|YP_003188440.1| WP_014457146.1.36695 WP_014457146.1.38618 WP_014457146.1.45580 WP_014457146.1.55019 WP_014457146.1.65311 WP_014457146.1.71918 WP_014457146.1.88241 WP_014457146.1.96488 WP_014457146.1.99323 gi|384119730|ref|YP_005502354.1| 634452.APA01_19360 gi|384054553|ref|YP_005487647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]