SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057804|ref|YP_005490471.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057804|ref|YP_005490471.1|
Domain Number 1 Region: 5-399
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.89e-118
Family AAT-like 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384057804|ref|YP_005490471.1|
Sequence length 401
Comment aspartate aminotransferase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MARSFANRLKGLPAPATIEMARRARALKAEGKPVISLALGEPDFATPPAVVEAAHQAALA
GQTKYPPVDGTPALKAAIARKFTRENGLDYKPEEIMVSNGGKQVIFNAFMATLNAGDEVV
VPTPYWVSYPLIARMFGATPVYVSCREEDGFRLKADELAKVLTSRTRWVVLNFPNNPTGG
VCSADDLRAIAEVLRQYPDIWILSDEIYEHLVFDGAKSASIAAVAPDLKDRTITLNGVSK
AYAMTGWRVGFAGGPADLIATMRGVQGNATSGVCSIAQAAAAAALDGPADLVQEMVATYG
RRRRMVVEALRAIPGFTCAMPDGAFYAYPGVAGCLGRTTAAGKRLETDHDFALALLEEAF
VATVPGSAFGHSPYLRLSCATADETLQEACQRIAQFVEGLQ
Download sequence
Identical sequences C7JD65
gi|384042945|ref|YP_005481689.1| gi|384054569|ref|YP_005487663.1| gi|384051462|ref|YP_005478525.1| gi|384060445|ref|YP_005499573.1| 634452.APA01_19530 WP_014457160.1.36695 WP_014457160.1.45580 WP_014457160.1.55019 WP_014457160.1.65311 WP_014457160.1.71918 WP_014457160.1.88241 WP_014457160.1.96488 WP_014457160.1.99323 gi|258543023|ref|YP_003188456.1| gi|384063737|ref|YP_005484379.1| gi|384119746|ref|YP_005502370.1| gi|384057804|ref|YP_005490471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]