SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384057975|ref|YP_005490642.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384057975|ref|YP_005490642.1|
Domain Number 1 Region: 3-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.71e-108
Family AAT-like 0.0000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384057975|ref|YP_005490642.1|
Sequence length 410
Comment aminotransferase AatC [Acetobacter pasteurianus IFO 3283-22]
Sequence
MTEEFHRIRRLPPYVFASVNQAKAAARARGEDIIDLGMGNPDTPTPQHIVNKLLETVQDP
RTHRYSVSRGIPGLRKAVAGYYERRFHVGLDPDKEVIVTLGSKEGLANLASAITSPGDTI
LVPNPSYPIHQFGFIIAGASIRSIPATPDENMLRALERAVRHSVPKPTALIVNFPSNPTA
YLADLDFYKELVAFCRKEEIWILSDLAYAEIYFGDLVPPSILAVPGAKDIAVEFTSLSKT
YSMAGWRVGFAAGNERLIAALTRIKSYLDYGAFTPIQVAAVTALNGPQDCVADLRALYKD
RRDVLIRGLHGAGWDVPSPEGSMFAWAPIPEPFREMGSVAFSKLLLEEAGVAVAPGLGFG
EYGDDHVRIGLVENTQRLRQALRSIRGFLSAHGISPSSPSSTKKPEPVAP
Download sequence
Identical sequences A0A1A0CY03 C7JE64 H1UPG7 S6CY75
gi|384119917|ref|YP_005502541.1| gi|529230996|ref|YP_008391811.1| gi|384054740|ref|YP_005487834.1| gi|384057975|ref|YP_005490642.1| gi|384060616|ref|YP_005499744.1| gi|384051633|ref|YP_005478696.1| gi|258543194|ref|YP_003188627.1| WP_003624415.1.13261 WP_003624415.1.36695 WP_003624415.1.36696 WP_003624415.1.37930 WP_003624415.1.38618 WP_003624415.1.45580 WP_003624415.1.55019 WP_003624415.1.62313 WP_003624415.1.64431 WP_003624415.1.65311 WP_003624415.1.71918 WP_003624415.1.82089 WP_003624415.1.88241 WP_003624415.1.96488 WP_003624415.1.99323 634452.APA01_21330 gi|384043116|ref|YP_005481860.1| gi|384063908|ref|YP_005484550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]