SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384058000|ref|YP_005490667.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384058000|ref|YP_005490667.1|
Domain Number 1 Region: 19-446
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-116
Family GABA-aminotransferase-like 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384058000|ref|YP_005490667.1|
Sequence length 449
Comment beta alanine--pyruvate transaminase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MVDMSSNFDSVNEARKGTYWQPFTSNRLLRADPEPRMLTKAEGIYYTSINGTRLLDTLSG
LWCTPLGHAHPRIAEAVKTQVETLDFAPSFQMTHPGAISLAERIAEMAPEGMNHVFFANS
GSESVDTALKVALGFHRIKGEGNRFRMIGRERGYHGVGFGGMSVGGIVSNRKMFAPCMMP
GVDHLRHPYEPEYAAFSHGQPTWGAERAEDLQRLVALHDASTIAAVIVEPVQGSTGVLVP
PVGYLERLREICTQNGILLIFDEVITGFGRMGAPFAAQRFGVKPDIITFAKAVTNGVVPM
GGVIVTDEIYNTFMTGPESAIEFCHGYTYSGHPLAAAVGHVVLDIMESEDIFARVRALEP
VLEEEVHGLKDLPCVSDIRNIGLTAAVDMKPIGGKPGARWSAVFEEGLRQGLLLRCTGDT
VSFGPPFVASEQELRGMIASFRKVLEAVG
Download sequence
Identical sequences C7JE89
gi|384043141|ref|YP_005481885.1| 634452.APA01_21580 gi|384119942|ref|YP_005502566.1| gi|384063933|ref|YP_005484575.1| gi|384058000|ref|YP_005490667.1| gi|384051658|ref|YP_005478721.1| gi|258543219|ref|YP_003188652.1| gi|384060641|ref|YP_005499769.1| WP_014457322.1.36695 WP_014457322.1.38618 WP_014457322.1.45580 WP_014457322.1.55019 WP_014457322.1.65311 WP_014457322.1.71918 WP_014457322.1.88241 WP_014457322.1.96488 WP_014457322.1.99323 gi|384054765|ref|YP_005487859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]