SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384058362|ref|YP_005491029.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384058362|ref|YP_005491029.1|
Domain Number 1 Region: 20-422
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.26e-122
Family GABA-aminotransferase-like 0.0000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384058362|ref|YP_005491029.1|
Sequence length 428
Comment 4-aminobutyrate aminotransferase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MATNKDLLNRRTNAVPRGVATSTPVFADRAENAEIWDVEGKRYVDFAGGIAVLNVGHRHP
KVMDAVKKQLDRFTHTAFQVSAYEPYIELAEKLNARAPFSGDAKTIFFTTGGEATENAVK
IARAATGRNGVIAFCGGFHGRTLLASALTGKVLPYKAPFGTLPGEVYHIPFPDGHDITVE
DSLKMLNFLFAADISPNNVAAIIIESVQGEGGFRVAPTALLKHLRAICDQHGIKLIADEV
QSGFARTGKLFGIEHSGVEPDLVCIAKSLAGGFPLSGVIGRAELMDSVPPGGLGGTYAGA
PLGCAAGLAVLDIIEEEKLLDRANSMGERLKARIAGWHKRTDMLPVSMPRGLGAMVAFDI
LERHEGMEQRKGFGSKLCARACEKGLILLACGVQGATIRILTPLTASDELVDEGLDIIEQ
ILLEEAKA
Download sequence
Identical sequences C7JG69
gi|258543585|ref|YP_003189018.1| gi|384043503|ref|YP_005482247.1| gi|384052020|ref|YP_005479083.1| gi|384058362|ref|YP_005491029.1| gi|384064295|ref|YP_005484937.1| gi|384055129|ref|YP_005488223.1| 634452.APA01_25330 gi|384061003|ref|YP_005500131.1| gi|384120308|ref|YP_005502932.1| WP_014457558.1.36695 WP_014457558.1.38618 WP_014457558.1.45580 WP_014457558.1.55019 WP_014457558.1.65311 WP_014457558.1.71918 WP_014457558.1.88241 WP_014457558.1.96488 WP_014457558.1.99323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]