SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384058422|ref|YP_005491089.1| from Acetobacter pasteurianus IFO 3283-22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384058422|ref|YP_005491089.1|
Domain Number 1 Region: 5-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.29e-92
Family Cystathionine synthase-like 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384058422|ref|YP_005491089.1|
Sequence length 387
Comment cysteine desulfurase [Acetobacter pasteurianus IFO 3283-22]
Sequence
MASSIYFDHAATTPCDPRVRAVLLDVLDHENGNPHSTTHEAGMRAADRVAHARNQVASLI
GADAKEIIFTSGATEANNLAIKGAVRHLAAQGSPRKRVITVATEHKCVLESVRDLAQEGF
EPVVLPVDVNGLLHPSVLQEALKVPTALVSIMAANNETGVLQDMPVLSRLVNEAGALLHS
DLAQAAGKIPVDVHAWDLALASVSSHKLYGPKGAGALFVRRRPRVRLAPLFSGGGQERGV
RSGTAPGFLVAAFGEACQIAKQELDTGFEHLSMLQRVFLNRLDAALPGCEVNAAAAPRLP
GIFNLRLPAGVSALDVVAVMPDLAVSLGSACSSAELAPSYVLEAMGLSREEAGRSLRLSP
GRFTSAAEAERAADNLAQAVLRVRSVT
Download sequence
Identical sequences C7JGW4
gi|384052080|ref|YP_005479143.1| WP_014457591.1.36695 WP_014457591.1.45580 WP_014457591.1.55019 WP_014457591.1.65311 WP_014457591.1.71918 WP_014457591.1.88241 WP_014457591.1.96488 WP_014457591.1.99323 gi|384058422|ref|YP_005491089.1| gi|384055189|ref|YP_005488283.1| gi|384043563|ref|YP_005482307.1| gi|384064355|ref|YP_005484997.1| 634452.APA01_26010 gi|258543645|ref|YP_003189078.1| gi|384061063|ref|YP_005500191.1| gi|384120368|ref|YP_005502992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]