SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209920553|ref|YP_002294637.1| from Escherichia coli SE11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209920553|ref|YP_002294637.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.48e-109
Family FMN-linked oxidoreductases 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.47e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000003
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-27
Family C-terminal domain of adrenodoxin reductase-like 0.000000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209920553|ref|YP_002294637.1|
Sequence length 672
Comment putative 2,4-dieonyl-CoA reductase [Escherichia coli SE11]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRTVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADIVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A2I6IAJ6 B6I453 E9TH46 I6BEM5
WP_000121484.1.101102 WP_000121484.1.15521 WP_000121484.1.15809 WP_000121484.1.15945 WP_000121484.1.16388 WP_000121484.1.16745 WP_000121484.1.17403 WP_000121484.1.20483 WP_000121484.1.21029 WP_000121484.1.24473 WP_000121484.1.24483 WP_000121484.1.26130 WP_000121484.1.26912 WP_000121484.1.29206 WP_000121484.1.30399 WP_000121484.1.30742 WP_000121484.1.35604 WP_000121484.1.36412 WP_000121484.1.37554 WP_000121484.1.37926 WP_000121484.1.39607 WP_000121484.1.40315 WP_000121484.1.45053 WP_000121484.1.4740 WP_000121484.1.49312 WP_000121484.1.51837 WP_000121484.1.53262 WP_000121484.1.54546 WP_000121484.1.54918 WP_000121484.1.5685 WP_000121484.1.57100 WP_000121484.1.59280 WP_000121484.1.59434 WP_000121484.1.6064 WP_000121484.1.61225 WP_000121484.1.61758 WP_000121484.1.63576 WP_000121484.1.65023 WP_000121484.1.66007 WP_000121484.1.68278 WP_000121484.1.68956 WP_000121484.1.71354 WP_000121484.1.7192 WP_000121484.1.72725 WP_000121484.1.72729 WP_000121484.1.73349 WP_000121484.1.74670 WP_000121484.1.74687 WP_000121484.1.77581 WP_000121484.1.77929 WP_000121484.1.78515 WP_000121484.1.7937 WP_000121484.1.79391 WP_000121484.1.80985 WP_000121484.1.81869 WP_000121484.1.83564 WP_000121484.1.87358 WP_000121484.1.87400 WP_000121484.1.89432 WP_000121484.1.8945 WP_000121484.1.8985 WP_000121484.1.9059 WP_000121484.1.91685 WP_000121484.1.93072 WP_000121484.1.93743 WP_000121484.1.93877 WP_000121484.1.93918 WP_000121484.1.95381 WP_000121484.1.95771 WP_000121484.1.95824 WP_000121484.1.96053 WP_000121484.1.96222 WP_000121484.1.97049 WP_000121484.1.97200 WP_000121484.1.98654 WP_000121484.1.99804 gi|209920553|ref|YP_002294637.1| 409438.ECSE_3362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]