SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209920038|ref|YP_002294122.1| from Escherichia coli SE11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209920038|ref|YP_002294122.1|
Domain Number 1 Region: 15-168
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.2e-60
Family Deoxycytidylate deaminase-like 0.0000000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209920038|ref|YP_002294122.1|
Sequence length 178
Comment tRNA-specific adenosine deaminase [Escherichia coli SE11]
Sequence
MRRAFITGVFFLSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPI
GRHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDA
KTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD
Download sequence
Identical sequences A0A0A0FFI7 A0A0E0XZ60 A0A0E1T568 A0A1S6TE72 A0A1S9JWX5 A0A1W2MRI4 A0A1X3I450 A0A1X3IJL0 A0A1X3L0I4 A0A226KCH5 A0A237E4J7 A0A237G006 B2TXX2 B6I5D3 B7LDF1 B7LV06 D2AHD0 D6JD33 D7XMQ4 D7Y9S6 D7ZII9 D8E2A8 E1J3P7 E3PGA3 E6BGZ0 E9TBZ8 F0JT44 F4NGL8 F4SI07 F4VF32 F5N5R2 G0FG76 I2XC34 J7R7D2 J7RTX1 K4VNQ6 K4W4S0 Q31XS8 U9XKC7 U9ZYW8 V0SRR2 V0XJU9 V0YC64 V6FYK7 V8FLB5 V8KDX6
gi|387622259|ref|YP_006129887.1| gi|157162036|ref|YP_001459354.1| gi|384544173|ref|YP_005728236.1| gi|218547914|ref|YP_002381705.1| gi|24113886|ref|NP_708396.1| gi|387613155|ref|YP_006116271.1| gi|544391123|ref|YP_008565705.1| gi|443618614|ref|YP_007382470.1| 198214.SF2606 198215.S2778 300268.SBO_2587 316407.tadA 331112.EcHS_A2712 344609.SbBS512_E2923 409438.ECSE_2847 413997.ECB_02453 585034.ECIAI1_2614 585054.EFER_0516 585055.EC55989_2846 gi|82545011|ref|YP_408958.1| gi|209920038|ref|YP_002294122.1| ET9 NYSGXRC-6463a NYSGXRC-T717 TADA_ECOLI gi|410481449|ref|YP_006768995.1| gi|407470455|ref|YP_006783102.1| gi|407480883|ref|YP_006778032.1| gi|471334231|ref|YP_007557708.1| gi|187730453|ref|YP_001881338.1| gi|254162534|ref|YP_003045642.1| gi|218555084|ref|YP_002387997.1| gi|387622259|ref|YP_006129887.1| NP_708396.1.23235 WP_001295367.1.1000 WP_001295367.1.100044 WP_001295367.1.100066 WP_001295367.1.100085 WP_001295367.1.100111 WP_001295367.1.100116 WP_001295367.1.100138 WP_001295367.1.100159 WP_001295367.1.100185 WP_001295367.1.100251 WP_001295367.1.10034 WP_001295367.1.100425 WP_001295367.1.100441 WP_001295367.1.100444 WP_001295367.1.100447 WP_001295367.1.100451 WP_001295367.1.100487 WP_001295367.1.100496 WP_001295367.1.100499 WP_001295367.1.10051 WP_001295367.1.100543 WP_001295367.1.100573 WP_001295367.1.100614 WP_001295367.1.100667 WP_001295367.1.10068 WP_001295367.1.100689 WP_001295367.1.100718 WP_001295367.1.100752 WP_001295367.1.100753 WP_001295367.1.100796 WP_001295367.1.10080 WP_001295367.1.100824 WP_001295367.1.100836 WP_001295367.1.10086 WP_001295367.1.100867 WP_001295367.1.100868 WP_001295367.1.100933 WP_001295367.1.10094 WP_001295367.1.100966 WP_001295367.1.100990 WP_001295367.1.101033 WP_001295367.1.101096 WP_001295367.1.101102 WP_001295367.1.101110 WP_001295367.1.101157 WP_001295367.1.101158 WP_001295367.1.101186 WP_001295367.1.101216 WP_001295367.1.10126 WP_001295367.1.101282 WP_001295367.1.101289 WP_001295367.1.101359 WP_001295367.1.101387 WP_001295367.1.101423 WP_001295367.1.101430 WP_001295367.1.101436 WP_001295367.1.101518 WP_001295367.1.101522 WP_001295367.1.101545 WP_001295367.1.101630 WP_001295367.1.101651 WP_001295367.1.101653 WP_001295367.1.101654 WP_001295367.1.101667 WP_001295367.1.101668 WP_001295367.1.101727 WP_001295367.1.10173 WP_001295367.1.101737 WP_001295367.1.101747 WP_001295367.1.101777 WP_001295367.1.101786 WP_001295367.1.10184 WP_001295367.1.101840 WP_001295367.1.101845 WP_001295367.1.10187 WP_001295367.1.10188 WP_001295367.1.10190 WP_001295367.1.101900 WP_001295367.1.101913 WP_001295367.1.101947 WP_001295367.1.101948 WP_001295367.1.101952 WP_001295367.1.101964 WP_001295367.1.101969 WP_001295367.1.101987 WP_001295367.1.102069 WP_001295367.1.102122 WP_001295367.1.10233 WP_001295367.1.10252 WP_001295367.1.10304 WP_001295367.1.10361 WP_001295367.1.10381 WP_001295367.1.1040 WP_001295367.1.10400 WP_001295367.1.10417 WP_001295367.1.10461 WP_001295367.1.10491 WP_001295367.1.10496 WP_001295367.1.10538 WP_001295367.1.10579 WP_001295367.1.1058 WP_001295367.1.10607 WP_001295367.1.10651 WP_001295367.1.10673 WP_001295367.1.10705 WP_001295367.1.1071 WP_001295367.1.10763 WP_001295367.1.10798 WP_001295367.1.10809 WP_001295367.1.10833 WP_001295367.1.10922 WP_001295367.1.10940 WP_001295367.1.10988 WP_001295367.1.10989 WP_001295367.1.10994 WP_001295367.1.11006 WP_001295367.1.11032 WP_001295367.1.11047 WP_001295367.1.11071 WP_001295367.1.11091 WP_001295367.1.11118 WP_001295367.1.1113 WP_001295367.1.112 WP_001295367.1.1122 WP_001295367.1.11296 WP_001295367.1.11418 WP_001295367.1.11436 WP_001295367.1.11437 WP_001295367.1.11524 WP_001295367.1.11578 WP_001295367.1.11616 WP_001295367.1.11645 WP_001295367.1.11699 WP_001295367.1.11759 WP_001295367.1.11801 WP_001295367.1.11803 WP_001295367.1.11844 WP_001295367.1.1186 WP_001295367.1.11912 WP_001295367.1.11949 WP_001295367.1.11955 WP_001295367.1.1196 WP_001295367.1.11981 WP_001295367.1.11982 WP_001295367.1.11985 WP_001295367.1.12030 WP_001295367.1.12036 WP_001295367.1.12051 WP_001295367.1.12060 WP_001295367.1.1212 WP_001295367.1.12319 WP_001295367.1.12320 WP_001295367.1.12342 WP_001295367.1.12344 WP_001295367.1.12415 WP_001295367.1.1242 WP_001295367.1.12458 WP_001295367.1.12468 WP_001295367.1.12478 WP_001295367.1.12542 WP_001295367.1.12558 WP_001295367.1.12566 WP_001295367.1.12582 WP_001295367.1.12594 WP_001295367.1.12623 WP_001295367.1.12645 WP_001295367.1.12675 WP_001295367.1.12679 WP_001295367.1.12680 WP_001295367.1.12693 WP_001295367.1.127 WP_001295367.1.12717 WP_001295367.1.12743 WP_001295367.1.12749 WP_001295367.1.1275 WP_001295367.1.12756 WP_001295367.1.12762 WP_001295367.1.12775 WP_001295367.1.12781 WP_001295367.1.12831 WP_001295367.1.12876 WP_001295367.1.12893 WP_001295367.1.12914 WP_001295367.1.1295 WP_001295367.1.12965 WP_001295367.1.12979 WP_001295367.1.13002 WP_001295367.1.13015 WP_001295367.1.13031 WP_001295367.1.13074 WP_001295367.1.1308 WP_001295367.1.1312 WP_001295367.1.13136 WP_001295367.1.13144 WP_001295367.1.1315 WP_001295367.1.13157 WP_001295367.1.13176 WP_001295367.1.13222 WP_001295367.1.13239 WP_001295367.1.13258 WP_001295367.1.13278 WP_001295367.1.13281 WP_001295367.1.13301 WP_001295367.1.13333 WP_001295367.1.1345 WP_001295367.1.13451 WP_001295367.1.13495 WP_001295367.1.13525 WP_001295367.1.13601 WP_001295367.1.13608 WP_001295367.1.13618 WP_001295367.1.13624 WP_001295367.1.13644 WP_001295367.1.13656 WP_001295367.1.13664 WP_001295367.1.13672 WP_001295367.1.13798 WP_001295367.1.13824 WP_001295367.1.13877 WP_001295367.1.13924 WP_001295367.1.13949 WP_001295367.1.13974 WP_001295367.1.14030 WP_001295367.1.14058 WP_001295367.1.14062 WP_001295367.1.14070 WP_001295367.1.14129 WP_001295367.1.1419 WP_001295367.1.14253 WP_001295367.1.14277 WP_001295367.1.14304 WP_001295367.1.14346 WP_001295367.1.1438 WP_001295367.1.1439 WP_001295367.1.14398 WP_001295367.1.14432 WP_001295367.1.14468 WP_001295367.1.14493 WP_001295367.1.14501 WP_001295367.1.14506 WP_001295367.1.14508 WP_001295367.1.14529 WP_001295367.1.14536 WP_001295367.1.14582 WP_001295367.1.14600 WP_001295367.1.14601 WP_001295367.1.1461 WP_001295367.1.14661 WP_001295367.1.14678 WP_001295367.1.14693 WP_001295367.1.1470 WP_001295367.1.14746 WP_001295367.1.14749 WP_001295367.1.14811 WP_001295367.1.14833 WP_001295367.1.14871 WP_001295367.1.14879 WP_001295367.1.14956 WP_001295367.1.14977 WP_001295367.1.14992 WP_001295367.1.15041 WP_001295367.1.1510 WP_001295367.1.15117 WP_001295367.1.1512 WP_001295367.1.15121 WP_001295367.1.15138 WP_001295367.1.15177 WP_001295367.1.15193 WP_001295367.1.15207 WP_001295367.1.15221 WP_001295367.1.1524 WP_001295367.1.15259 WP_001295367.1.15270 WP_001295367.1.15277 WP_001295367.1.15282 WP_001295367.1.153 WP_001295367.1.15332 WP_001295367.1.15335 WP_001295367.1.15347 WP_001295367.1.15416 WP_001295367.1.1543 WP_001295367.1.15444 WP_001295367.1.15521 WP_001295367.1.15528 WP_001295367.1.15538 WP_001295367.1.15576 WP_001295367.1.15583 WP_001295367.1.15593 WP_001295367.1.15600 WP_001295367.1.1561 WP_001295367.1.15620 WP_001295367.1.15645 WP_001295367.1.15707 WP_001295367.1.15740 WP_001295367.1.15747 WP_001295367.1.15752 WP_001295367.1.15767 WP_001295367.1.15768 WP_001295367.1.15791 WP_001295367.1.15809 WP_001295367.1.1582 WP_001295367.1.15855 WP_001295367.1.1588 WP_001295367.1.15916 WP_001295367.1.15945 WP_001295367.1.16014 WP_001295367.1.16034 WP_001295367.1.16086 WP_001295367.1.16087 WP_001295367.1.1609 WP_001295367.1.16102 WP_001295367.1.16111 WP_001295367.1.16171 WP_001295367.1.16179 WP_001295367.1.16183 WP_001295367.1.16194 WP_001295367.1.16294 WP_001295367.1.163 WP_001295367.1.16322 WP_001295367.1.1634 WP_001295367.1.16387 WP_001295367.1.16388 WP_001295367.1.16435 WP_001295367.1.16500 WP_001295367.1.16517 WP_001295367.1.16532 WP_001295367.1.16539 WP_001295367.1.16541 WP_001295367.1.1655 WP_001295367.1.16577 WP_001295367.1.16592 WP_001295367.1.16612 WP_001295367.1.16648 WP_001295367.1.16682 WP_001295367.1.16715 WP_001295367.1.16721 WP_001295367.1.1673 WP_001295367.1.16745 WP_001295367.1.16752 WP_001295367.1.16766 WP_001295367.1.16805 WP_001295367.1.16818 WP_001295367.1.16861 WP_001295367.1.16862 WP_001295367.1.16979 WP_001295367.1.16992 WP_001295367.1.17017 WP_001295367.1.17018 WP_001295367.1.17084 WP_001295367.1.17087 WP_001295367.1.1710 WP_001295367.1.17102 WP_001295367.1.17111 WP_001295367.1.17114 WP_001295367.1.17119 WP_001295367.1.17123 WP_001295367.1.17150 WP_001295367.1.17170 WP_001295367.1.17172 WP_001295367.1.17182 WP_001295367.1.17216 WP_001295367.1.17241 WP_001295367.1.17242 WP_001295367.1.17282 WP_001295367.1.17290 WP_001295367.1.17297 WP_001295367.1.17333 WP_001295367.1.17356 WP_001295367.1.17360 WP_001295367.1.17373 WP_001295367.1.17403 WP_001295367.1.17410 WP_001295367.1.17432 WP_001295367.1.17464 WP_001295367.1.17534 WP_001295367.1.1755 WP_001295367.1.17550 WP_001295367.1.17577 WP_001295367.1.17595 WP_001295367.1.17623 WP_001295367.1.1763 WP_001295367.1.17637 WP_001295367.1.1766 WP_001295367.1.1769 WP_001295367.1.17701 WP_001295367.1.17711 WP_001295367.1.17734 WP_001295367.1.17766 WP_001295367.1.17802 WP_001295367.1.17829 WP_001295367.1.17831 WP_001295367.1.17889 WP_001295367.1.17920 WP_001295367.1.17952 WP_001295367.1.17961 WP_001295367.1.17963 WP_001295367.1.17984 WP_001295367.1.18000 WP_001295367.1.18006 WP_001295367.1.18050 WP_001295367.1.18064 WP_001295367.1.18094 WP_001295367.1.18133 WP_001295367.1.18134 WP_001295367.1.18164 WP_001295367.1.18175 WP_001295367.1.18225 WP_001295367.1.18226 WP_001295367.1.18229 WP_001295367.1.18316 WP_001295367.1.18329 WP_001295367.1.18338 WP_001295367.1.18381 WP_001295367.1.18402 WP_001295367.1.18410 WP_001295367.1.18436 WP_001295367.1.18438 WP_001295367.1.18458 WP_001295367.1.18482 WP_001295367.1.18530 WP_001295367.1.18550 WP_001295367.1.18588 WP_001295367.1.18617 WP_001295367.1.18649 WP_001295367.1.18650 WP_001295367.1.18651 WP_001295367.1.18666 WP_001295367.1.1867 WP_001295367.1.18714 WP_001295367.1.1873 WP_001295367.1.18734 WP_001295367.1.18858 WP_001295367.1.18861 WP_001295367.1.18874 WP_001295367.1.18899 WP_001295367.1.18929 WP_001295367.1.18936 WP_001295367.1.19024 WP_001295367.1.1906 WP_001295367.1.19075 WP_001295367.1.1909 WP_001295367.1.19090 WP_001295367.1.19100 WP_001295367.1.19114 WP_001295367.1.19129 WP_001295367.1.19147 WP_001295367.1.19148 WP_001295367.1.19150 WP_001295367.1.19194 WP_001295367.1.19205 WP_001295367.1.19206 WP_001295367.1.1925 WP_001295367.1.19277 WP_001295367.1.193 WP_001295367.1.19312 WP_001295367.1.19313 WP_001295367.1.19332 WP_001295367.1.19347 WP_001295367.1.19361 WP_001295367.1.19389 WP_001295367.1.19424 WP_001295367.1.19441 WP_001295367.1.19453 WP_001295367.1.19478 WP_001295367.1.19494 WP_001295367.1.19544 WP_001295367.1.19557 WP_001295367.1.19581 WP_001295367.1.19583 WP_001295367.1.1963 WP_001295367.1.19644 WP_001295367.1.19651 WP_001295367.1.19655 WP_001295367.1.19684 WP_001295367.1.19691 WP_001295367.1.19778 WP_001295367.1.19795 WP_001295367.1.1982 WP_001295367.1.19878 WP_001295367.1.19889 WP_001295367.1.19940 WP_001295367.1.19957 WP_001295367.1.19994 WP_001295367.1.20114 WP_001295367.1.20129 WP_001295367.1.20133 WP_001295367.1.20136 WP_001295367.1.2015 WP_001295367.1.20151 WP_001295367.1.20157 WP_001295367.1.20159 WP_001295367.1.20164 WP_001295367.1.20166 WP_001295367.1.20170 WP_001295367.1.20183 WP_001295367.1.20215 WP_001295367.1.20251 WP_001295367.1.20308 WP_001295367.1.20325 WP_001295367.1.20331 WP_001295367.1.20334 WP_001295367.1.20388 WP_001295367.1.20445 WP_001295367.1.20483 WP_001295367.1.20484 WP_001295367.1.20493 WP_001295367.1.20506 WP_001295367.1.20515 WP_001295367.1.20519 WP_001295367.1.20536 WP_001295367.1.20549 WP_001295367.1.20596 WP_001295367.1.2063 WP_001295367.1.20638 WP_001295367.1.20691 WP_001295367.1.20730 WP_001295367.1.20737 WP_001295367.1.20785 WP_001295367.1.20824 WP_001295367.1.20841 WP_001295367.1.20848 WP_001295367.1.20863 WP_001295367.1.20907 WP_001295367.1.20943 WP_001295367.1.20958 WP_001295367.1.20982 WP_001295367.1.2100 WP_001295367.1.21017 WP_001295367.1.21020 WP_001295367.1.21024 WP_001295367.1.21029 WP_001295367.1.21033 WP_001295367.1.21041 WP_001295367.1.21057 WP_001295367.1.21104 WP_001295367.1.21122 WP_001295367.1.21137 WP_001295367.1.21251 WP_001295367.1.21320 WP_001295367.1.21336 WP_001295367.1.21441 WP_001295367.1.21470 WP_001295367.1.2156 WP_001295367.1.21573 WP_001295367.1.21596 WP_001295367.1.21628 WP_001295367.1.2164 WP_001295367.1.21667 WP_001295367.1.21732 WP_001295367.1.21733 WP_001295367.1.21758 WP_001295367.1.21771 WP_001295367.1.21823 WP_001295367.1.21887 WP_001295367.1.21915 WP_001295367.1.21945 WP_001295367.1.21986 WP_001295367.1.22021 WP_001295367.1.22060 WP_001295367.1.22098 WP_001295367.1.22113 WP_001295367.1.22138 WP_001295367.1.22195 WP_001295367.1.22204 WP_001295367.1.22269 WP_001295367.1.22280 WP_001295367.1.22291 WP_001295367.1.22314 WP_001295367.1.22325 WP_001295367.1.22328 WP_001295367.1.22350 WP_001295367.1.22359 WP_001295367.1.22363 WP_001295367.1.22409 WP_001295367.1.22450 WP_001295367.1.22494 WP_001295367.1.22522 WP_001295367.1.22544 WP_001295367.1.22574 WP_001295367.1.22579 WP_001295367.1.22631 WP_001295367.1.22632 WP_001295367.1.22649 WP_001295367.1.22662 WP_001295367.1.22669 WP_001295367.1.22685 WP_001295367.1.22690 WP_001295367.1.22756 WP_001295367.1.22765 WP_001295367.1.22771 WP_001295367.1.22777 WP_001295367.1.22783 WP_001295367.1.22830 WP_001295367.1.22868 WP_001295367.1.22875 WP_001295367.1.22885 WP_001295367.1.22896 WP_001295367.1.22908 WP_001295367.1.2300 WP_001295367.1.23005 WP_001295367.1.23026 WP_001295367.1.23035 WP_001295367.1.23042 WP_001295367.1.23044 WP_001295367.1.23078 WP_001295367.1.23090 WP_001295367.1.23092 WP_001295367.1.23105 WP_001295367.1.23135 WP_001295367.1.2325 WP_001295367.1.23285 WP_001295367.1.23290 WP_001295367.1.23330 WP_001295367.1.23351 WP_001295367.1.23378 WP_001295367.1.23383 WP_001295367.1.23388 WP_001295367.1.23393 WP_001295367.1.23463 WP_001295367.1.23487 WP_001295367.1.23511 WP_001295367.1.23527 WP_001295367.1.23549 WP_001295367.1.23593 WP_001295367.1.2362 WP_001295367.1.23622 WP_001295367.1.23640 WP_001295367.1.23676 WP_001295367.1.23693 WP_001295367.1.23724 WP_001295367.1.23741 WP_001295367.1.23754 WP_001295367.1.23804 WP_001295367.1.23812 WP_001295367.1.23898 WP_001295367.1.23915 WP_001295367.1.23945 WP_001295367.1.2395 WP_001295367.1.23950 WP_001295367.1.23953 WP_001295367.1.23960 WP_001295367.1.23985 WP_001295367.1.24024 WP_001295367.1.24068 WP_001295367.1.24088 WP_001295367.1.24089 WP_001295367.1.24122 WP_001295367.1.24136 WP_001295367.1.2418 WP_001295367.1.24278 WP_001295367.1.2428 WP_001295367.1.2430 WP_001295367.1.24304 WP_001295367.1.24316 WP_001295367.1.2433 WP_001295367.1.24362 WP_001295367.1.24374 WP_001295367.1.24381 WP_001295367.1.24383 WP_001295367.1.24460 WP_001295367.1.24473 WP_001295367.1.24483 WP_001295367.1.24485 WP_001295367.1.24499 WP_001295367.1.24523 WP_001295367.1.24536 WP_001295367.1.24547 WP_001295367.1.24575 WP_001295367.1.24583 WP_001295367.1.24616 WP_001295367.1.24641 WP_001295367.1.24646 WP_001295367.1.24693 WP_001295367.1.24808 WP_001295367.1.24876 WP_001295367.1.24899 WP_001295367.1.24929 WP_001295367.1.24939 WP_001295367.1.24946 WP_001295367.1.24960 WP_001295367.1.24984 WP_001295367.1.25019 WP_001295367.1.25038 WP_001295367.1.25039 WP_001295367.1.2504 WP_001295367.1.25042 WP_001295367.1.25050 WP_001295367.1.25085 WP_001295367.1.25086 WP_001295367.1.25087 WP_001295367.1.25126 WP_001295367.1.25141 WP_001295367.1.25183 WP_001295367.1.25203 WP_001295367.1.25272 WP_001295367.1.2531 WP_001295367.1.25312 WP_001295367.1.25324 WP_001295367.1.25378 WP_001295367.1.2543 WP_001295367.1.2558 WP_001295367.1.25592 WP_001295367.1.25613 WP_001295367.1.25631 WP_001295367.1.25643 WP_001295367.1.25681 WP_001295367.1.25713 WP_001295367.1.25724 WP_001295367.1.25726 WP_001295367.1.25799 WP_001295367.1.25832 WP_001295367.1.25843 WP_001295367.1.2588 WP_001295367.1.25886 WP_001295367.1.25945 WP_001295367.1.2597 WP_001295367.1.25996 WP_001295367.1.26005 WP_001295367.1.26048 WP_001295367.1.26055 WP_001295367.1.26100 WP_001295367.1.26125 WP_001295367.1.26130 WP_001295367.1.26161 WP_001295367.1.26186 WP_001295367.1.26191 WP_001295367.1.26264 WP_001295367.1.26270 WP_001295367.1.26325 WP_001295367.1.26331 WP_001295367.1.2637 WP_001295367.1.26379 WP_001295367.1.26391 WP_001295367.1.26401 WP_001295367.1.26403 WP_001295367.1.2642 WP_001295367.1.26479 WP_001295367.1.26480 WP_001295367.1.26517 WP_001295367.1.26569 WP_001295367.1.26588 WP_001295367.1.26598 WP_001295367.1.26609 WP_001295367.1.26613 WP_001295367.1.26644 WP_001295367.1.26658 WP_001295367.1.26683 WP_001295367.1.26716 WP_001295367.1.26720 WP_001295367.1.26912 WP_001295367.1.26943 WP_001295367.1.27019 WP_001295367.1.27057 WP_001295367.1.27060 WP_001295367.1.27098 WP_001295367.1.27101 WP_001295367.1.2712 WP_001295367.1.27134 WP_001295367.1.27148 WP_001295367.1.27175 WP_001295367.1.27188 WP_001295367.1.27214 WP_001295367.1.27260 WP_001295367.1.27280 WP_001295367.1.27287 WP_001295367.1.27292 WP_001295367.1.2731 WP_001295367.1.27310 WP_001295367.1.27313 WP_001295367.1.27330 WP_001295367.1.27367 WP_001295367.1.27373 WP_001295367.1.27424 WP_001295367.1.27426 WP_001295367.1.27451 WP_001295367.1.27472 WP_001295367.1.27504 WP_001295367.1.2755 WP_001295367.1.27560 WP_001295367.1.27580 WP_001295367.1.27611 WP_001295367.1.27691 WP_001295367.1.27693 WP_001295367.1.27698 WP_001295367.1.27741 WP_001295367.1.27742 WP_001295367.1.27749 WP_001295367.1.27758 WP_001295367.1.27774 WP_001295367.1.27856 WP_001295367.1.27876 WP_001295367.1.27879 WP_001295367.1.27897 WP_001295367.1.27923 WP_001295367.1.27971 WP_001295367.1.28046 WP_001295367.1.2811 WP_001295367.1.28110 WP_001295367.1.28128 WP_001295367.1.28184 WP_001295367.1.28250 WP_001295367.1.2826 WP_001295367.1.28268 WP_001295367.1.28271 WP_001295367.1.28305 WP_001295367.1.28371 WP_001295367.1.28401 WP_001295367.1.28480 WP_001295367.1.28491 WP_001295367.1.28496 WP_001295367.1.28509 WP_001295367.1.28536 WP_001295367.1.28540 WP_001295367.1.28544 WP_001295367.1.28662 WP_001295367.1.28683 WP_001295367.1.28697 WP_001295367.1.28711 WP_001295367.1.28760 WP_001295367.1.28809 WP_001295367.1.2881 WP_001295367.1.28919 WP_001295367.1.28950 WP_001295367.1.28953 WP_001295367.1.28994 WP_001295367.1.290 WP_001295367.1.29001 WP_001295367.1.29013 WP_001295367.1.29016 WP_001295367.1.29026 WP_001295367.1.29061 WP_001295367.1.29082 WP_001295367.1.29125 WP_001295367.1.29128 WP_001295367.1.29150 WP_001295367.1.29164 WP_001295367.1.29176 WP_001295367.1.29194 WP_001295367.1.29202 WP_001295367.1.29206 WP_001295367.1.29221 WP_001295367.1.29230 WP_001295367.1.29239 WP_001295367.1.2926 WP_001295367.1.2931 WP_001295367.1.2942 WP_001295367.1.2945 WP_001295367.1.29486 WP_001295367.1.29497 WP_001295367.1.29503 WP_001295367.1.29504 WP_001295367.1.2952 WP_001295367.1.29603 WP_001295367.1.29669 WP_001295367.1.29683 WP_001295367.1.29689 WP_001295367.1.29715 WP_001295367.1.29724 WP_001295367.1.29746 WP_001295367.1.29752 WP_001295367.1.29798 WP_001295367.1.29812 WP_001295367.1.29874 WP_001295367.1.29876 WP_001295367.1.2995 WP_001295367.1.29967 WP_001295367.1.29992 WP_001295367.1.30004 WP_001295367.1.30035 WP_001295367.1.30098 WP_001295367.1.30123 WP_001295367.1.30231 WP_001295367.1.30247 WP_001295367.1.30253 WP_001295367.1.30391 WP_001295367.1.30399 WP_001295367.1.30428 WP_001295367.1.3045 WP_001295367.1.30452 WP_001295367.1.30472 WP_001295367.1.30479 WP_001295367.1.30497 WP_001295367.1.30546 WP_001295367.1.30554 WP_001295367.1.306 WP_001295367.1.30630 WP_001295367.1.30639 WP_001295367.1.30640 WP_001295367.1.30733 WP_001295367.1.30742 WP_001295367.1.30749 WP_001295367.1.30783 WP_001295367.1.30843 WP_001295367.1.30853 WP_001295367.1.30866 WP_001295367.1.31009 WP_001295367.1.31089 WP_001295367.1.31142 WP_001295367.1.31188 WP_001295367.1.31211 WP_001295367.1.31295 WP_001295367.1.31319 WP_001295367.1.31340 WP_001295367.1.31347 WP_001295367.1.31357 WP_001295367.1.31379 WP_001295367.1.31407 WP_001295367.1.31419 WP_001295367.1.31421 WP_001295367.1.31429 WP_001295367.1.31431 WP_001295367.1.31506 WP_001295367.1.31509 WP_001295367.1.31518 WP_001295367.1.31521 WP_001295367.1.31614 WP_001295367.1.31618 WP_001295367.1.31681 WP_001295367.1.31709 WP_001295367.1.31740 WP_001295367.1.3176 WP_001295367.1.31803 WP_001295367.1.3181 WP_001295367.1.31833 WP_001295367.1.31835 WP_001295367.1.31839 WP_001295367.1.31860 WP_001295367.1.31866 WP_001295367.1.31898 WP_001295367.1.31928 WP_001295367.1.3193 WP_001295367.1.31978 WP_001295367.1.3201 WP_001295367.1.3203 WP_001295367.1.32089 WP_001295367.1.32091 WP_001295367.1.32093 WP_001295367.1.32094 WP_001295367.1.3212 WP_001295367.1.32121 WP_001295367.1.32127 WP_001295367.1.32138 WP_001295367.1.32142 WP_001295367.1.32143 WP_001295367.1.3215 WP_001295367.1.32232 WP_001295367.1.32234 WP_001295367.1.32236 WP_001295367.1.32287 WP_001295367.1.32394 WP_001295367.1.32443 WP_001295367.1.3247 WP_001295367.1.32475 WP_001295367.1.32479 WP_001295367.1.3248 WP_001295367.1.32509 WP_001295367.1.32558 WP_001295367.1.32561 WP_001295367.1.32591 WP_001295367.1.32601 WP_001295367.1.32709 WP_001295367.1.32722 WP_001295367.1.32724 WP_001295367.1.32811 WP_001295367.1.32815 WP_001295367.1.32831 WP_001295367.1.32875 WP_001295367.1.32903 WP_001295367.1.32910 WP_001295367.1.32946 WP_001295367.1.32959 WP_001295367.1.32972 WP_001295367.1.32984 WP_001295367.1.32992 WP_001295367.1.32995 WP_001295367.1.33004 WP_001295367.1.33014 WP_001295367.1.33018 WP_001295367.1.33026 WP_001295367.1.33119 WP_001295367.1.33238 WP_001295367.1.33244 WP_001295367.1.33325 WP_001295367.1.33341 WP_001295367.1.33352 WP_001295367.1.33385 WP_001295367.1.33408 WP_001295367.1.33422 WP_001295367.1.33424 WP_001295367.1.33502 WP_001295367.1.33526 WP_001295367.1.3354 WP_001295367.1.33545 WP_001295367.1.33565 WP_001295367.1.33595 WP_001295367.1.33638 WP_001295367.1.33648 WP_001295367.1.33667 WP_001295367.1.33680 WP_001295367.1.33736 WP_001295367.1.33746 WP_001295367.1.33751 WP_001295367.1.33823 WP_001295367.1.33853 WP_001295367.1.33854 WP_001295367.1.33879 WP_001295367.1.33888 WP_001295367.1.33914 WP_001295367.1.33952 WP_001295367.1.33973 WP_001295367.1.33974 WP_001295367.1.3398 WP_001295367.1.3401 WP_001295367.1.34032 WP_001295367.1.34094 WP_001295367.1.34122 WP_001295367.1.34124 WP_001295367.1.342 WP_001295367.1.34270 WP_001295367.1.34273 WP_001295367.1.34277 WP_001295367.1.34332 WP_001295367.1.34341 WP_001295367.1.34363 WP_001295367.1.34397 WP_001295367.1.34400 WP_001295367.1.3444 WP_001295367.1.34456 WP_001295367.1.34464 WP_001295367.1.34470 WP_001295367.1.34525 WP_001295367.1.34532 WP_001295367.1.34538 WP_001295367.1.34605 WP_001295367.1.34682 WP_001295367.1.347 WP_001295367.1.34727 WP_001295367.1.34781 WP_001295367.1.34782 WP_001295367.1.34794 WP_001295367.1.34855 WP_001295367.1.34948 WP_001295367.1.34966 WP_001295367.1.34982 WP_001295367.1.34990 WP_001295367.1.34993 WP_001295367.1.35003 WP_001295367.1.35006 WP_001295367.1.35039 WP_001295367.1.35114 WP_001295367.1.35180 WP_001295367.1.35195 WP_001295367.1.35204 WP_001295367.1.35211 WP_001295367.1.35220 WP_001295367.1.35316 WP_001295367.1.35360 WP_001295367.1.35365 WP_001295367.1.35368 WP_001295367.1.35376 WP_001295367.1.3539 WP_001295367.1.35448 WP_001295367.1.35465 WP_001295367.1.35466 WP_001295367.1.35468 WP_001295367.1.35552 WP_001295367.1.35581 WP_001295367.1.3560 WP_001295367.1.35604 WP_001295367.1.35649 WP_001295367.1.35653 WP_001295367.1.35704 WP_001295367.1.35724 WP_001295367.1.35789 WP_001295367.1.35922 WP_001295367.1.35927 WP_001295367.1.35942 WP_001295367.1.3598 WP_001295367.1.35990 WP_001295367.1.36042 WP_001295367.1.36070 WP_001295367.1.36071 WP_001295367.1.36085 WP_001295367.1.36129 WP_001295367.1.36164 WP_001295367.1.36166 WP_001295367.1.36177 WP_001295367.1.36182 WP_001295367.1.36332 WP_001295367.1.36334 WP_001295367.1.36352 WP_001295367.1.36386 WP_001295367.1.36393 WP_001295367.1.36412 WP_001295367.1.36496 WP_001295367.1.36500 WP_001295367.1.36507 WP_001295367.1.36523 WP_001295367.1.36531 WP_001295367.1.36610 WP_001295367.1.36628 WP_001295367.1.36699 WP_001295367.1.36707 WP_001295367.1.36739 WP_001295367.1.36746 WP_001295367.1.36747 WP_001295367.1.36806 WP_001295367.1.36812 WP_001295367.1.36826 WP_001295367.1.36925 WP_001295367.1.36975 WP_001295367.1.37020 WP_001295367.1.37046 WP_001295367.1.37049 WP_001295367.1.37122 WP_001295367.1.37153 WP_001295367.1.37155 WP_001295367.1.3723 WP_001295367.1.37233 WP_001295367.1.37252 WP_001295367.1.37261 WP_001295367.1.37290 WP_001295367.1.37329 WP_001295367.1.37352 WP_001295367.1.37371 WP_001295367.1.37433 WP_001295367.1.37445 WP_001295367.1.37476 WP_001295367.1.37485 WP_001295367.1.37510 WP_001295367.1.37516 WP_001295367.1.37538 WP_001295367.1.37549 WP_001295367.1.37554 WP_001295367.1.37576 WP_001295367.1.37588 WP_001295367.1.37634 WP_001295367.1.37637 WP_001295367.1.377 WP_001295367.1.3772 WP_001295367.1.37730 WP_001295367.1.37745 WP_001295367.1.37750 WP_001295367.1.37758 WP_001295367.1.37762 WP_001295367.1.37773 WP_001295367.1.37817 WP_001295367.1.37830 WP_001295367.1.37852 WP_001295367.1.37880 WP_001295367.1.37887 WP_001295367.1.37897 WP_001295367.1.37917 WP_001295367.1.37923 WP_001295367.1.37926 WP_001295367.1.37964 WP_001295367.1.37967 WP_001295367.1.37995 WP_001295367.1.38033 WP_001295367.1.38043 WP_001295367.1.38080 WP_001295367.1.38081 WP_001295367.1.38085 WP_001295367.1.38103 WP_001295367.1.38105 WP_001295367.1.3811 WP_001295367.1.38119 WP_001295367.1.38120 WP_001295367.1.3815 WP_001295367.1.38155 WP_001295367.1.38162 WP_001295367.1.38182 WP_001295367.1.38185 WP_001295367.1.38202 WP_001295367.1.38257 WP_001295367.1.38314 WP_001295367.1.38323 WP_001295367.1.38357 WP_001295367.1.38363 WP_001295367.1.38371 WP_001295367.1.38485 WP_001295367.1.38533 WP_001295367.1.38544 WP_001295367.1.38584 WP_001295367.1.38626 WP_001295367.1.38629 WP_001295367.1.38636 WP_001295367.1.38694 WP_001295367.1.38722 WP_001295367.1.3873 WP_001295367.1.38777 WP_001295367.1.38811 WP_001295367.1.38843 WP_001295367.1.38896 WP_001295367.1.38911 WP_001295367.1.38920 WP_001295367.1.38956 WP_001295367.1.39005 WP_001295367.1.3904 WP_001295367.1.39042 WP_001295367.1.39063 WP_001295367.1.39103 WP_001295367.1.39123 WP_001295367.1.39148 WP_001295367.1.39150 WP_001295367.1.39164 WP_001295367.1.39167 WP_001295367.1.39171 WP_001295367.1.39184 WP_001295367.1.39249 WP_001295367.1.39286 WP_001295367.1.39302 WP_001295367.1.39342 WP_001295367.1.39356 WP_001295367.1.39358 WP_001295367.1.39365 WP_001295367.1.39367 WP_001295367.1.39402 WP_001295367.1.39430 WP_001295367.1.39481 WP_001295367.1.39492 WP_001295367.1.39509 WP_001295367.1.3954 WP_001295367.1.39541 WP_001295367.1.39594 WP_001295367.1.39606 WP_001295367.1.39607 WP_001295367.1.39610 WP_001295367.1.39636 WP_001295367.1.39690 WP_001295367.1.3970 WP_001295367.1.39733 WP_001295367.1.39758 WP_001295367.1.39796 WP_001295367.1.3980 WP_001295367.1.39818 WP_001295367.1.39822 WP_001295367.1.39829 WP_001295367.1.39870 WP_001295367.1.39938 WP_001295367.1.39961 WP_001295367.1.39966 WP_001295367.1.39973 WP_001295367.1.39992 WP_001295367.1.39998 WP_001295367.1.40016 WP_001295367.1.40088 WP_001295367.1.40147 WP_001295367.1.40192 WP_001295367.1.4020 WP_001295367.1.40206 WP_001295367.1.40212 WP_001295367.1.40218 WP_001295367.1.40238 WP_001295367.1.40249 WP_001295367.1.40315 WP_001295367.1.40317 WP_001295367.1.40319 WP_001295367.1.40335 WP_001295367.1.40382 WP_001295367.1.40389 WP_001295367.1.40403 WP_001295367.1.40445 WP_001295367.1.4049 WP_001295367.1.40499 WP_001295367.1.40502 WP_001295367.1.40509 WP_001295367.1.40524 WP_001295367.1.40548 WP_001295367.1.40596 WP_001295367.1.40599 WP_001295367.1.406 WP_001295367.1.40617 WP_001295367.1.40666 WP_001295367.1.40686 WP_001295367.1.40712 WP_001295367.1.40813 WP_001295367.1.40815 WP_001295367.1.4082 WP_001295367.1.40833 WP_001295367.1.40842 WP_001295367.1.40865 WP_001295367.1.40898 WP_001295367.1.40912 WP_001295367.1.40937 WP_001295367.1.40965 WP_001295367.1.41037 WP_001295367.1.41125 WP_001295367.1.41147 WP_001295367.1.41206 WP_001295367.1.41239 WP_001295367.1.4126 WP_001295367.1.41263 WP_001295367.1.41271 WP_001295367.1.41315 WP_001295367.1.41339 WP_001295367.1.41346 WP_001295367.1.41363 WP_001295367.1.41371 WP_001295367.1.41391 WP_001295367.1.41392 WP_001295367.1.41394 WP_001295367.1.41402 WP_001295367.1.41407 WP_001295367.1.41417 WP_001295367.1.4142 WP_001295367.1.41436 WP_001295367.1.41449 WP_001295367.1.41455 WP_001295367.1.41466 WP_001295367.1.41483 WP_001295367.1.41484 WP_001295367.1.41513 WP_001295367.1.41530 WP_001295367.1.41539 WP_001295367.1.41545 WP_001295367.1.41556 WP_001295367.1.41566 WP_001295367.1.41613 WP_001295367.1.41651 WP_001295367.1.41740 WP_001295367.1.41741 WP_001295367.1.41752 WP_001295367.1.41780 WP_001295367.1.41782 WP_001295367.1.41784 WP_001295367.1.41812 WP_001295367.1.41826 WP_001295367.1.41837 WP_001295367.1.41885 WP_001295367.1.41900 WP_001295367.1.41960 WP_001295367.1.41988 WP_001295367.1.42022 WP_001295367.1.42033 WP_001295367.1.42038 WP_001295367.1.42138 WP_001295367.1.4214 WP_001295367.1.42151 WP_001295367.1.42159 WP_001295367.1.42179 WP_001295367.1.42203 WP_001295367.1.42209 WP_001295367.1.42214 WP_001295367.1.42221 WP_001295367.1.42233 WP_001295367.1.4224 WP_001295367.1.42252 WP_001295367.1.42318 WP_001295367.1.42367 WP_001295367.1.42376 WP_001295367.1.42387 WP_001295367.1.42415 WP_001295367.1.4242 WP_001295367.1.42432 WP_001295367.1.42442 WP_001295367.1.42448 WP_001295367.1.42516 WP_001295367.1.42522 WP_001295367.1.42547 WP_001295367.1.42632 WP_001295367.1.42661 WP_001295367.1.42748 WP_001295367.1.42749 WP_001295367.1.42770 WP_001295367.1.42813 WP_001295367.1.4282 WP_001295367.1.42832 WP_001295367.1.42879 WP_001295367.1.42880 WP_001295367.1.42891 WP_001295367.1.4290 WP_001295367.1.42918 WP_001295367.1.42936 WP_001295367.1.42937 WP_001295367.1.42950 WP_001295367.1.42987 WP_001295367.1.42989 WP_001295367.1.43035 WP_001295367.1.4306 WP_001295367.1.43133 WP_001295367.1.43137 WP_001295367.1.43174 WP_001295367.1.43177 WP_001295367.1.43213 WP_001295367.1.43270 WP_001295367.1.43316 WP_001295367.1.43363 WP_001295367.1.43389 WP_001295367.1.4342 WP_001295367.1.43444 WP_001295367.1.43455 WP_001295367.1.43473 WP_001295367.1.43474 WP_001295367.1.43489 WP_001295367.1.43561 WP_001295367.1.43598 WP_001295367.1.43622 WP_001295367.1.43750 WP_001295367.1.43804 WP_001295367.1.43925 WP_001295367.1.43966 WP_001295367.1.43989 WP_001295367.1.44018 WP_001295367.1.44020 WP_001295367.1.44029 WP_001295367.1.44075 WP_001295367.1.44077 WP_001295367.1.44088 WP_001295367.1.44096 WP_001295367.1.44100 WP_001295367.1.44115 WP_001295367.1.4415 WP_001295367.1.44162 WP_001295367.1.44166 WP_001295367.1.44201 WP_001295367.1.44211 WP_001295367.1.44222 WP_001295367.1.44238 WP_001295367.1.44285 WP_001295367.1.44292 WP_001295367.1.44324 WP_001295367.1.44354 WP_001295367.1.44365 WP_001295367.1.44445 WP_001295367.1.4445 WP_001295367.1.44452 WP_001295367.1.44458 WP_001295367.1.44461 WP_001295367.1.4449 WP_001295367.1.44524 WP_001295367.1.44558 WP_001295367.1.44570 WP_001295367.1.44587 WP_001295367.1.44608 WP_001295367.1.44610 WP_001295367.1.44627 WP_001295367.1.44661 WP_001295367.1.44671 WP_001295367.1.44724 WP_001295367.1.4473 WP_001295367.1.44756 WP_001295367.1.44784 WP_001295367.1.44821 WP_001295367.1.44840 WP_001295367.1.44841 WP_001295367.1.44849 WP_001295367.1.44854 WP_001295367.1.44857 WP_001295367.1.44923 WP_001295367.1.44960 WP_001295367.1.44970 WP_001295367.1.44980 WP_001295367.1.45000 WP_001295367.1.45025 WP_001295367.1.45043 WP_001295367.1.45053 WP_001295367.1.45104 WP_001295367.1.45116 WP_001295367.1.4516 WP_001295367.1.45246 WP_001295367.1.45301 WP_001295367.1.45313 WP_001295367.1.45329 WP_001295367.1.4535 WP_001295367.1.45359 WP_001295367.1.45392 WP_001295367.1.45440 WP_001295367.1.45486 WP_001295367.1.4549 WP_001295367.1.45538 WP_001295367.1.45581 WP_001295367.1.4574 WP_001295367.1.45741 WP_001295367.1.45752 WP_001295367.1.45799 WP_001295367.1.45840 WP_001295367.1.45846 WP_001295367.1.45868 WP_001295367.1.4593 WP_001295367.1.45933 WP_001295367.1.45945 WP_001295367.1.45949 WP_001295367.1.45960 WP_001295367.1.45968 WP_001295367.1.4600 WP_001295367.1.46026 WP_001295367.1.46049 WP_001295367.1.46070 WP_001295367.1.46081 WP_001295367.1.46097 WP_001295367.1.46105 WP_001295367.1.46115 WP_001295367.1.46122 WP_001295367.1.4613 WP_001295367.1.46186 WP_001295367.1.46197 WP_001295367.1.46213 WP_001295367.1.46239 WP_001295367.1.46257 WP_001295367.1.46301 WP_001295367.1.46325 WP_001295367.1.46329 WP_001295367.1.46429 WP_001295367.1.46433 WP_001295367.1.46441 WP_001295367.1.4646 WP_001295367.1.46477 WP_001295367.1.46526 WP_001295367.1.46555 WP_001295367.1.4657 WP_001295367.1.46573 WP_001295367.1.46582 WP_001295367.1.46602 WP_001295367.1.46614 WP_001295367.1.46616 WP_001295367.1.46668 WP_001295367.1.46802 WP_001295367.1.46820 WP_001295367.1.46860 WP_001295367.1.46876 WP_001295367.1.46882 WP_001295367.1.46898 WP_001295367.1.46909 WP_001295367.1.4691 WP_001295367.1.46912 WP_001295367.1.46932 WP_001295367.1.46990 WP_001295367.1.46994 WP_001295367.1.46999 WP_001295367.1.47028 WP_001295367.1.47029 WP_001295367.1.47034 WP_001295367.1.47038 WP_001295367.1.47048 WP_001295367.1.47050 WP_001295367.1.47063 WP_001295367.1.47069 WP_001295367.1.47156 WP_001295367.1.47186 WP_001295367.1.47198 WP_001295367.1.4722 WP_001295367.1.47224 WP_001295367.1.47280 WP_001295367.1.47307 WP_001295367.1.47319 WP_001295367.1.47322 WP_001295367.1.47332 WP_001295367.1.47363 WP_001295367.1.47370 WP_001295367.1.47386 WP_001295367.1.4740 WP_001295367.1.47414 WP_001295367.1.47425 WP_001295367.1.47464 WP_001295367.1.47473 WP_001295367.1.47477 WP_001295367.1.47496 WP_001295367.1.47500 WP_001295367.1.47533 WP_001295367.1.47546 WP_001295367.1.47555 WP_001295367.1.47634 WP_001295367.1.47646 WP_001295367.1.47662 WP_001295367.1.47673 WP_001295367.1.4772 WP_001295367.1.47722 WP_001295367.1.47734 WP_001295367.1.47740 WP_001295367.1.47744 WP_001295367.1.47761 WP_001295367.1.47764 WP_001295367.1.47765 WP_001295367.1.47770 WP_001295367.1.47775 WP_001295367.1.47790 WP_001295367.1.47791 WP_001295367.1.47820 WP_001295367.1.47848 WP_001295367.1.4785 WP_001295367.1.4796 WP_001295367.1.47962 WP_001295367.1.48000 WP_001295367.1.48018 WP_001295367.1.48029 WP_001295367.1.48048 WP_001295367.1.48073 WP_001295367.1.48077 WP_001295367.1.48111 WP_001295367.1.48144 WP_001295367.1.48168 WP_001295367.1.48188 WP_001295367.1.48194 WP_001295367.1.48203 WP_001295367.1.48222 WP_001295367.1.48229 WP_001295367.1.48290 WP_001295367.1.48291 WP_001295367.1.48353 WP_001295367.1.48355 WP_001295367.1.48371 WP_001295367.1.48385 WP_001295367.1.48421 WP_001295367.1.48433 WP_001295367.1.48477 WP_001295367.1.48480 WP_001295367.1.48483 WP_001295367.1.48505 WP_001295367.1.48522 WP_001295367.1.4857 WP_001295367.1.48571 WP_001295367.1.486 WP_001295367.1.48678 WP_001295367.1.4871 WP_001295367.1.4876 WP_001295367.1.48771 WP_001295367.1.48801 WP_001295367.1.48847 WP_001295367.1.48860 WP_001295367.1.48901 WP_001295367.1.48926 WP_001295367.1.48928 WP_001295367.1.48953 WP_001295367.1.48954 WP_001295367.1.48970 WP_001295367.1.48974 WP_001295367.1.49009 WP_001295367.1.49104 WP_001295367.1.49107 WP_001295367.1.49124 WP_001295367.1.49147 WP_001295367.1.49190 WP_001295367.1.49229 WP_001295367.1.49236 WP_001295367.1.49243 WP_001295367.1.49312 WP_001295367.1.49336 WP_001295367.1.49363 WP_001295367.1.49459 WP_001295367.1.49482 WP_001295367.1.4953 WP_001295367.1.49531 WP_001295367.1.49537 WP_001295367.1.49558 WP_001295367.1.49621 WP_001295367.1.49645 WP_001295367.1.49661 WP_001295367.1.497 WP_001295367.1.49712 WP_001295367.1.49722 WP_001295367.1.49733 WP_001295367.1.49740 WP_001295367.1.49768 WP_001295367.1.49774 WP_001295367.1.49856 WP_001295367.1.49861 WP_001295367.1.49879 WP_001295367.1.49900 WP_001295367.1.49950 WP_001295367.1.49954 WP_001295367.1.49987 WP_001295367.1.50006 WP_001295367.1.50008 WP_001295367.1.50036 WP_001295367.1.50078 WP_001295367.1.50113 WP_001295367.1.50119 WP_001295367.1.5017 WP_001295367.1.50179 WP_001295367.1.50182 WP_001295367.1.50191 WP_001295367.1.50258 WP_001295367.1.50266 WP_001295367.1.50269 WP_001295367.1.50353 WP_001295367.1.50361 WP_001295367.1.50366 WP_001295367.1.50412 WP_001295367.1.50418 WP_001295367.1.50427 WP_001295367.1.50452 WP_001295367.1.5056 WP_001295367.1.50564 WP_001295367.1.50579 WP_001295367.1.50586 WP_001295367.1.50616 WP_001295367.1.5064 WP_001295367.1.5067 WP_001295367.1.50715 WP_001295367.1.50717 WP_001295367.1.50725 WP_001295367.1.50728 WP_001295367.1.50939 WP_001295367.1.50947 WP_001295367.1.5095 WP_001295367.1.50969 WP_001295367.1.50996 WP_001295367.1.51013 WP_001295367.1.51042 WP_001295367.1.51058 WP_001295367.1.5106 WP_001295367.1.51109 WP_001295367.1.51172 WP_001295367.1.51175 WP_001295367.1.51206 WP_001295367.1.51248 WP_001295367.1.51255 WP_001295367.1.51260 WP_001295367.1.51278 WP_001295367.1.5128 WP_001295367.1.51299 WP_001295367.1.51300 WP_001295367.1.51307 WP_001295367.1.51323 WP_001295367.1.51325 WP_001295367.1.51330 WP_001295367.1.51380 WP_001295367.1.51425 WP_001295367.1.51430 WP_001295367.1.51441 WP_001295367.1.5146 WP_001295367.1.51462 WP_001295367.1.51495 WP_001295367.1.51525 WP_001295367.1.51537 WP_001295367.1.51548 WP_001295367.1.51552 WP_001295367.1.5157 WP_001295367.1.51580 WP_001295367.1.51587 WP_001295367.1.51600 WP_001295367.1.51607 WP_001295367.1.51629 WP_001295367.1.51690 WP_001295367.1.51718 WP_001295367.1.51736 WP_001295367.1.51784 WP_001295367.1.51837 WP_001295367.1.51873 WP_001295367.1.51968 WP_001295367.1.51988 WP_001295367.1.51999 WP_001295367.1.52002 WP_001295367.1.52020 WP_001295367.1.52062 WP_001295367.1.52076 WP_001295367.1.52127 WP_001295367.1.52135 WP_001295367.1.52171 WP_001295367.1.52186 WP_001295367.1.52200 WP_001295367.1.52211 WP_001295367.1.52243 WP_001295367.1.52249 WP_001295367.1.5227 WP_001295367.1.52270 WP_001295367.1.52272 WP_001295367.1.52305 WP_001295367.1.52378 WP_001295367.1.5239 WP_001295367.1.52399 WP_001295367.1.52406 WP_001295367.1.52419 WP_001295367.1.52421 WP_001295367.1.52492 WP_001295367.1.52524 WP_001295367.1.52558 WP_001295367.1.52612 WP_001295367.1.5265 WP_001295367.1.52691 WP_001295367.1.52704 WP_001295367.1.5272 WP_001295367.1.52735 WP_001295367.1.52762 WP_001295367.1.52774 WP_001295367.1.52777 WP_001295367.1.52781 WP_001295367.1.52801 WP_001295367.1.52844 WP_001295367.1.52852 WP_001295367.1.52853 WP_001295367.1.52855 WP_001295367.1.52881 WP_001295367.1.52895 WP_001295367.1.52908 WP_001295367.1.5291 WP_001295367.1.52913 WP_001295367.1.52962 WP_001295367.1.52995 WP_001295367.1.53012 WP_001295367.1.53020 WP_001295367.1.53027 WP_001295367.1.53065 WP_001295367.1.53095 WP_001295367.1.5310 WP_001295367.1.53110 WP_001295367.1.53155 WP_001295367.1.532 WP_001295367.1.53223 WP_001295367.1.53228 WP_001295367.1.53238 WP_001295367.1.53242 WP_001295367.1.53244 WP_001295367.1.53251 WP_001295367.1.53262 WP_001295367.1.53327 WP_001295367.1.53364 WP_001295367.1.53377 WP_001295367.1.53401 WP_001295367.1.5342 WP_001295367.1.53428 WP_001295367.1.53482 WP_001295367.1.53505 WP_001295367.1.53537 WP_001295367.1.53545 WP_001295367.1.53590 WP_001295367.1.53592 WP_001295367.1.53594 WP_001295367.1.53706 WP_001295367.1.53809 WP_001295367.1.53863 WP_001295367.1.53866 WP_001295367.1.53931 WP_001295367.1.53966 WP_001295367.1.53972 WP_001295367.1.53978 WP_001295367.1.53994 WP_001295367.1.54013 WP_001295367.1.54028 WP_001295367.1.54032 WP_001295367.1.54091 WP_001295367.1.54104 WP_001295367.1.54144 WP_001295367.1.54169 WP_001295367.1.54185 WP_001295367.1.54202 WP_001295367.1.54263 WP_001295367.1.54307 WP_001295367.1.54317 WP_001295367.1.54328 WP_001295367.1.54329 WP_001295367.1.54344 WP_001295367.1.54359 WP_001295367.1.54429 WP_001295367.1.54463 WP_001295367.1.54476 WP_001295367.1.54507 WP_001295367.1.54546 WP_001295367.1.54585 WP_001295367.1.54591 WP_001295367.1.5460 WP_001295367.1.54602 WP_001295367.1.54605 WP_001295367.1.5461 WP_001295367.1.54617 WP_001295367.1.54620 WP_001295367.1.54695 WP_001295367.1.5470 WP_001295367.1.54769 WP_001295367.1.5479 WP_001295367.1.54798 WP_001295367.1.54817 WP_001295367.1.54829 WP_001295367.1.54918 WP_001295367.1.54941 WP_001295367.1.54972 WP_001295367.1.54981 WP_001295367.1.54989 WP_001295367.1.54991 WP_001295367.1.54993 WP_001295367.1.55003 WP_001295367.1.55005 WP_001295367.1.55009 WP_001295367.1.55041 WP_001295367.1.55070 WP_001295367.1.55112 WP_001295367.1.55115 WP_001295367.1.5512 WP_001295367.1.55123 WP_001295367.1.55134 WP_001295367.1.55185 WP_001295367.1.55197 WP_001295367.1.5520 WP_001295367.1.55203 WP_001295367.1.55222 WP_001295367.1.55338 WP_001295367.1.55342 WP_001295367.1.55381 WP_001295367.1.55417 WP_001295367.1.55424 WP_001295367.1.55425 WP_001295367.1.55489 WP_001295367.1.55507 WP_001295367.1.55529 WP_001295367.1.55551 WP_001295367.1.55552 WP_001295367.1.55560 WP_001295367.1.55563 WP_001295367.1.55571 WP_001295367.1.55574 WP_001295367.1.55597 WP_001295367.1.55608 WP_001295367.1.5561 WP_001295367.1.55629 WP_001295367.1.55676 WP_001295367.1.55709 WP_001295367.1.55720 WP_001295367.1.55730 WP_001295367.1.55757 WP_001295367.1.55787 WP_001295367.1.55825 WP_001295367.1.55844 WP_001295367.1.55868 WP_001295367.1.55870 WP_001295367.1.55988 WP_001295367.1.561 WP_001295367.1.5614 WP_001295367.1.56149 WP_001295367.1.5616 WP_001295367.1.56164 WP_001295367.1.56169 WP_001295367.1.56193 WP_001295367.1.56197 WP_001295367.1.56285 WP_001295367.1.56302 WP_001295367.1.56358 WP_001295367.1.56371 WP_001295367.1.56390 WP_001295367.1.56436 WP_001295367.1.5646 WP_001295367.1.56513 WP_001295367.1.56528 WP_001295367.1.56543 WP_001295367.1.56665 WP_001295367.1.56680 WP_001295367.1.56689 WP_001295367.1.5670 WP_001295367.1.56742 WP_001295367.1.56786 WP_001295367.1.56789 WP_001295367.1.56799 WP_001295367.1.56830 WP_001295367.1.56835 WP_001295367.1.56846 WP_001295367.1.5685 WP_001295367.1.56871 WP_001295367.1.56882 WP_001295367.1.56932 WP_001295367.1.56934 WP_001295367.1.56978 WP_001295367.1.56980 WP_001295367.1.57051 WP_001295367.1.57072 WP_001295367.1.57086 WP_001295367.1.57100 WP_001295367.1.57124 WP_001295367.1.57150 WP_001295367.1.57181 WP_001295367.1.57216 WP_001295367.1.57281 WP_001295367.1.57348 WP_001295367.1.57349 WP_001295367.1.57395 WP_001295367.1.57401 WP_001295367.1.57403 WP_001295367.1.57410 WP_001295367.1.57414 WP_001295367.1.57432 WP_001295367.1.57538 WP_001295367.1.5755 WP_001295367.1.57558 WP_001295367.1.57629 WP_001295367.1.57638 WP_001295367.1.57659 WP_001295367.1.57669 WP_001295367.1.57719 WP_001295367.1.57738 WP_001295367.1.57812 WP_001295367.1.57846 WP_001295367.1.57851 WP_001295367.1.57904 WP_001295367.1.58001 WP_001295367.1.58022 WP_001295367.1.58045 WP_001295367.1.58060 WP_001295367.1.58080 WP_001295367.1.5810 WP_001295367.1.58128 WP_001295367.1.58136 WP_001295367.1.58143 WP_001295367.1.58146 WP_001295367.1.58163 WP_001295367.1.58172 WP_001295367.1.58206 WP_001295367.1.58226 WP_001295367.1.58232 WP_001295367.1.58336 WP_001295367.1.58371 WP_001295367.1.58384 WP_001295367.1.58401 WP_001295367.1.5842 WP_001295367.1.58420 WP_001295367.1.58429 WP_001295367.1.58440 WP_001295367.1.58444 WP_001295367.1.58445 WP_001295367.1.58475 WP_001295367.1.58507 WP_001295367.1.58514 WP_001295367.1.58528 WP_001295367.1.58547 WP_001295367.1.58572 WP_001295367.1.58582 WP_001295367.1.58622 WP_001295367.1.58705 WP_001295367.1.58837 WP_001295367.1.58867 WP_001295367.1.58870 WP_001295367.1.58940 WP_001295367.1.58951 WP_001295367.1.58958 WP_001295367.1.58976 WP_001295367.1.58977 WP_001295367.1.58983 WP_001295367.1.59024 WP_001295367.1.59035 WP_001295367.1.59047 WP_001295367.1.59083 WP_001295367.1.59165 WP_001295367.1.59174 WP_001295367.1.59190 WP_001295367.1.59226 WP_001295367.1.59280 WP_001295367.1.59293 WP_001295367.1.59306 WP_001295367.1.59407 WP_001295367.1.59409 WP_001295367.1.59413 WP_001295367.1.59423 WP_001295367.1.59434 WP_001295367.1.59513 WP_001295367.1.59533 WP_001295367.1.59553 WP_001295367.1.59590 WP_001295367.1.59615 WP_001295367.1.59621 WP_001295367.1.59638 WP_001295367.1.5965 WP_001295367.1.59699 WP_001295367.1.59717 WP_001295367.1.59730 WP_001295367.1.59737 WP_001295367.1.59756 WP_001295367.1.59781 WP_001295367.1.59782 WP_001295367.1.59788 WP_001295367.1.59823 WP_001295367.1.59836 WP_001295367.1.59853 WP_001295367.1.59877 WP_001295367.1.59912 WP_001295367.1.59989 WP_001295367.1.59998 WP_001295367.1.6002 WP_001295367.1.60031 WP_001295367.1.60048 WP_001295367.1.60067 WP_001295367.1.60070 WP_001295367.1.60095 WP_001295367.1.60151 WP_001295367.1.6022 WP_001295367.1.60225 WP_001295367.1.60228 WP_001295367.1.60325 WP_001295367.1.60342 WP_001295367.1.60343 WP_001295367.1.60387 WP_001295367.1.60436 WP_001295367.1.60453 WP_001295367.1.60477 WP_001295367.1.60491 WP_001295367.1.60498 WP_001295367.1.60550 WP_001295367.1.60567 WP_001295367.1.60576 WP_001295367.1.6059 WP_001295367.1.60606 WP_001295367.1.6061 WP_001295367.1.6064 WP_001295367.1.6066 WP_001295367.1.60717 WP_001295367.1.60732 WP_001295367.1.60764 WP_001295367.1.60805 WP_001295367.1.60835 WP_001295367.1.60895 WP_001295367.1.60901 WP_001295367.1.60927 WP_001295367.1.61005 WP_001295367.1.61008 WP_001295367.1.61035 WP_001295367.1.61058 WP_001295367.1.6106 WP_001295367.1.61096 WP_001295367.1.6110 WP_001295367.1.61102 WP_001295367.1.61112 WP_001295367.1.61170 WP_001295367.1.61174 WP_001295367.1.61175 WP_001295367.1.61181 WP_001295367.1.61225 WP_001295367.1.61241 WP_001295367.1.61292 WP_001295367.1.61505 WP_001295367.1.61512 WP_001295367.1.61517 WP_001295367.1.61551 WP_001295367.1.61608 WP_001295367.1.61636 WP_001295367.1.61663 WP_001295367.1.61758 WP_001295367.1.61770 WP_001295367.1.61779 WP_001295367.1.61806 WP_001295367.1.61858 WP_001295367.1.61926 WP_001295367.1.61939 WP_001295367.1.61948 WP_001295367.1.61949 WP_001295367.1.61955 WP_001295367.1.61957 WP_001295367.1.62041 WP_001295367.1.62099 WP_001295367.1.6212 WP_001295367.1.62264 WP_001295367.1.62266 WP_001295367.1.62273 WP_001295367.1.62282 WP_001295367.1.62290 WP_001295367.1.62296 WP_001295367.1.62337 WP_001295367.1.62447 WP_001295367.1.62460 WP_001295367.1.62487 WP_001295367.1.62514 WP_001295367.1.62529 WP_001295367.1.62541 WP_001295367.1.62612 WP_001295367.1.62642 WP_001295367.1.62646 WP_001295367.1.62668 WP_001295367.1.62681 WP_001295367.1.62714 WP_001295367.1.62735 WP_001295367.1.62750 WP_001295367.1.62762 WP_001295367.1.62812 WP_001295367.1.62818 WP_001295367.1.62840 WP_001295367.1.62851 WP_001295367.1.62919 WP_001295367.1.6293 WP_001295367.1.62931 WP_001295367.1.62959 WP_001295367.1.62989 WP_001295367.1.6299 WP_001295367.1.6307 WP_001295367.1.63113 WP_001295367.1.63167 WP_001295367.1.63177 WP_001295367.1.63189 WP_001295367.1.6323 WP_001295367.1.63246 WP_001295367.1.63287 WP_001295367.1.63350 WP_001295367.1.6337 WP_001295367.1.63370 WP_001295367.1.63374 WP_001295367.1.63393 WP_001295367.1.63437 WP_001295367.1.63453 WP_001295367.1.63466 WP_001295367.1.63467 WP_001295367.1.63478 WP_001295367.1.63487 WP_001295367.1.63491 WP_001295367.1.63554 WP_001295367.1.63556 WP_001295367.1.63576 WP_001295367.1.63612 WP_001295367.1.63666 WP_001295367.1.63679 WP_001295367.1.63703 WP_001295367.1.63721 WP_001295367.1.63746 WP_001295367.1.63821 WP_001295367.1.63964 WP_001295367.1.64014 WP_001295367.1.64040 WP_001295367.1.64045 WP_001295367.1.64050 WP_001295367.1.64074 WP_001295367.1.64080 WP_001295367.1.64110 WP_001295367.1.64153 WP_001295367.1.6416 WP_001295367.1.64165 WP_001295367.1.64175 WP_001295367.1.64193 WP_001295367.1.64285 WP_001295367.1.64286 WP_001295367.1.6431 WP_001295367.1.64321 WP_001295367.1.64337 WP_001295367.1.64353 WP_001295367.1.64355 WP_001295367.1.64356 WP_001295367.1.6441 WP_001295367.1.64438 WP_001295367.1.64448 WP_001295367.1.64458 WP_001295367.1.64519 WP_001295367.1.64528 WP_001295367.1.64657 WP_001295367.1.64695 WP_001295367.1.64707 WP_001295367.1.64749 WP_001295367.1.64784 WP_001295367.1.64789 WP_001295367.1.64793 WP_001295367.1.64881 WP_001295367.1.64912 WP_001295367.1.64926 WP_001295367.1.64930 WP_001295367.1.64970 WP_001295367.1.6499 WP_001295367.1.65023 WP_001295367.1.65040 WP_001295367.1.65056 WP_001295367.1.65061 WP_001295367.1.65097 WP_001295367.1.651 WP_001295367.1.65151 WP_001295367.1.65155 WP_001295367.1.65179 WP_001295367.1.65206 WP_001295367.1.65256 WP_001295367.1.65271 WP_001295367.1.65306 WP_001295367.1.65353 WP_001295367.1.65364 WP_001295367.1.6537 WP_001295367.1.65370 WP_001295367.1.654 WP_001295367.1.65408 WP_001295367.1.65415 WP_001295367.1.65484 WP_001295367.1.65493 WP_001295367.1.65531 WP_001295367.1.65596 WP_001295367.1.65662 WP_001295367.1.65672 WP_001295367.1.65912 WP_001295367.1.65961 WP_001295367.1.65962 WP_001295367.1.6599 WP_001295367.1.66001 WP_001295367.1.66007 WP_001295367.1.66022 WP_001295367.1.66050 WP_001295367.1.66059 WP_001295367.1.66104 WP_001295367.1.66105 WP_001295367.1.66161 WP_001295367.1.66181 WP_001295367.1.66187 WP_001295367.1.66197 WP_001295367.1.66251 WP_001295367.1.66280 WP_001295367.1.66288 WP_001295367.1.66327 WP_001295367.1.6635 WP_001295367.1.66387 WP_001295367.1.66389 WP_001295367.1.66395 WP_001295367.1.6645 WP_001295367.1.66501 WP_001295367.1.6654 WP_001295367.1.66550 WP_001295367.1.66559 WP_001295367.1.66579 WP_001295367.1.66624 WP_001295367.1.6665 WP_001295367.1.66700 WP_001295367.1.66719 WP_001295367.1.66758 WP_001295367.1.6676 WP_001295367.1.66783 WP_001295367.1.66795 WP_001295367.1.66849 WP_001295367.1.66926 WP_001295367.1.66933 WP_001295367.1.66948 WP_001295367.1.66978 WP_001295367.1.6701 WP_001295367.1.67018 WP_001295367.1.67021 WP_001295367.1.67022 WP_001295367.1.67026 WP_001295367.1.67102 WP_001295367.1.67120 WP_001295367.1.67194 WP_001295367.1.67200 WP_001295367.1.67209 WP_001295367.1.6723 WP_001295367.1.67272 WP_001295367.1.67278 WP_001295367.1.67293 WP_001295367.1.6735 WP_001295367.1.67383 WP_001295367.1.67412 WP_001295367.1.67415 WP_001295367.1.67454 WP_001295367.1.67468 WP_001295367.1.67522 WP_001295367.1.67538 WP_001295367.1.67553 WP_001295367.1.67581 WP_001295367.1.67663 WP_001295367.1.67681 WP_001295367.1.67685 WP_001295367.1.67701 WP_001295367.1.67724 WP_001295367.1.67732 WP_001295367.1.67786 WP_001295367.1.67787 WP_001295367.1.67788 WP_001295367.1.678 WP_001295367.1.67841 WP_001295367.1.67853 WP_001295367.1.67971 WP_001295367.1.67990 WP_001295367.1.67992 WP_001295367.1.67999 WP_001295367.1.68008 WP_001295367.1.68011 WP_001295367.1.6802 WP_001295367.1.68025 WP_001295367.1.6803 WP_001295367.1.68039 WP_001295367.1.68067 WP_001295367.1.68079 WP_001295367.1.6814 WP_001295367.1.68170 WP_001295367.1.68175 WP_001295367.1.682 WP_001295367.1.68215 WP_001295367.1.68271 WP_001295367.1.68278 WP_001295367.1.68283 WP_001295367.1.68300 WP_001295367.1.68336 WP_001295367.1.68341 WP_001295367.1.68347 WP_001295367.1.68395 WP_001295367.1.68396 WP_001295367.1.68442 WP_001295367.1.68534 WP_001295367.1.68566 WP_001295367.1.6860 WP_001295367.1.68609 WP_001295367.1.68695 WP_001295367.1.68697 WP_001295367.1.68711 WP_001295367.1.68731 WP_001295367.1.68750 WP_001295367.1.68751 WP_001295367.1.6877 WP_001295367.1.68797 WP_001295367.1.68801 WP_001295367.1.68865 WP_001295367.1.68915 WP_001295367.1.68956 WP_001295367.1.6897 WP_001295367.1.68989 WP_001295367.1.69033 WP_001295367.1.69098 WP_001295367.1.69126 WP_001295367.1.69127 WP_001295367.1.69144 WP_001295367.1.6916 WP_001295367.1.6923 WP_001295367.1.69247 WP_001295367.1.69303 WP_001295367.1.69305 WP_001295367.1.69341 WP_001295367.1.69390 WP_001295367.1.694 WP_001295367.1.69404 WP_001295367.1.6945 WP_001295367.1.69472 WP_001295367.1.69473 WP_001295367.1.69551 WP_001295367.1.69583 WP_001295367.1.69589 WP_001295367.1.69593 WP_001295367.1.69605 WP_001295367.1.69646 WP_001295367.1.69649 WP_001295367.1.69786 WP_001295367.1.69803 WP_001295367.1.69868 WP_001295367.1.69887 WP_001295367.1.6993 WP_001295367.1.69972 WP_001295367.1.70063 WP_001295367.1.7013 WP_001295367.1.70149 WP_001295367.1.70191 WP_001295367.1.70213 WP_001295367.1.70251 WP_001295367.1.70341 WP_001295367.1.70357 WP_001295367.1.70370 WP_001295367.1.70407 WP_001295367.1.70477 WP_001295367.1.70492 WP_001295367.1.7052 WP_001295367.1.70592 WP_001295367.1.70619 WP_001295367.1.70628 WP_001295367.1.70694 WP_001295367.1.70748 WP_001295367.1.70767 WP_001295367.1.70794 WP_001295367.1.70801 WP_001295367.1.70803 WP_001295367.1.70880 WP_001295367.1.70896 WP_001295367.1.7090 WP_001295367.1.70900 WP_001295367.1.70967 WP_001295367.1.71024 WP_001295367.1.71042 WP_001295367.1.71062 WP_001295367.1.71109 WP_001295367.1.71113 WP_001295367.1.71134 WP_001295367.1.71144 WP_001295367.1.71147 WP_001295367.1.71149 WP_001295367.1.71158 WP_001295367.1.71159 WP_001295367.1.71183 WP_001295367.1.71192 WP_001295367.1.71199 WP_001295367.1.71221 WP_001295367.1.71229 WP_001295367.1.71272 WP_001295367.1.71275 WP_001295367.1.71285 WP_001295367.1.71312 WP_001295367.1.71315 WP_001295367.1.71323 WP_001295367.1.71327 WP_001295367.1.71339 WP_001295367.1.71354 WP_001295367.1.71397 WP_001295367.1.71403 WP_001295367.1.71480 WP_001295367.1.71522 WP_001295367.1.71537 WP_001295367.1.71540 WP_001295367.1.71603 WP_001295367.1.71632 WP_001295367.1.71724 WP_001295367.1.71757 WP_001295367.1.71767 WP_001295367.1.71783 WP_001295367.1.71837 WP_001295367.1.71856 WP_001295367.1.71874 WP_001295367.1.7192 WP_001295367.1.71938 WP_001295367.1.71944 WP_001295367.1.71975 WP_001295367.1.71987 WP_001295367.1.71993 WP_001295367.1.72013 WP_001295367.1.72021 WP_001295367.1.72033 WP_001295367.1.7205 WP_001295367.1.72053 WP_001295367.1.7210 WP_001295367.1.72153 WP_001295367.1.72157 WP_001295367.1.72162 WP_001295367.1.72184 WP_001295367.1.72186 WP_001295367.1.72237 WP_001295367.1.72240 WP_001295367.1.7225 WP_001295367.1.72261 WP_001295367.1.72270 WP_001295367.1.72279 WP_001295367.1.72316 WP_001295367.1.72337 WP_001295367.1.72342 WP_001295367.1.72397 WP_001295367.1.72431 WP_001295367.1.72449 WP_001295367.1.72485 WP_001295367.1.72493 WP_001295367.1.72511 WP_001295367.1.72521 WP_001295367.1.72522 WP_001295367.1.72535 WP_001295367.1.72537 WP_001295367.1.72544 WP_001295367.1.72582 WP_001295367.1.72608 WP_001295367.1.72619 WP_001295367.1.72643 WP_001295367.1.72652 WP_001295367.1.72663 WP_001295367.1.72695 WP_001295367.1.72698 WP_001295367.1.72725 WP_001295367.1.72729 WP_001295367.1.72745 WP_001295367.1.72747 WP_001295367.1.72748 WP_001295367.1.72751 WP_001295367.1.72758 WP_001295367.1.72764 WP_001295367.1.7277 WP_001295367.1.72837 WP_001295367.1.72858 WP_001295367.1.72860 WP_001295367.1.72910 WP_001295367.1.72947 WP_001295367.1.73000 WP_001295367.1.73032 WP_001295367.1.73039 WP_001295367.1.7307 WP_001295367.1.73072 WP_001295367.1.73075 WP_001295367.1.73085 WP_001295367.1.73094 WP_001295367.1.73197 WP_001295367.1.73217 WP_001295367.1.73249 WP_001295367.1.73251 WP_001295367.1.73257 WP_001295367.1.73259 WP_001295367.1.73292 WP_001295367.1.73295 WP_001295367.1.73326 WP_001295367.1.73340 WP_001295367.1.73349 WP_001295367.1.73385 WP_001295367.1.73430 WP_001295367.1.7349 WP_001295367.1.73524 WP_001295367.1.73565 WP_001295367.1.73604 WP_001295367.1.73663 WP_001295367.1.73700 WP_001295367.1.73709 WP_001295367.1.73717 WP_001295367.1.7376 WP_001295367.1.73797 WP_001295367.1.73807 WP_001295367.1.73827 WP_001295367.1.73835 WP_001295367.1.73843 WP_001295367.1.73844 WP_001295367.1.73846 WP_001295367.1.73859 WP_001295367.1.73882 WP_001295367.1.73897 WP_001295367.1.73942 WP_001295367.1.73992 WP_001295367.1.73995 WP_001295367.1.73996 WP_001295367.1.74051 WP_001295367.1.7411 WP_001295367.1.7413 WP_001295367.1.74156 WP_001295367.1.74184 WP_001295367.1.7424 WP_001295367.1.7425 WP_001295367.1.74309 WP_001295367.1.74365 WP_001295367.1.74423 WP_001295367.1.74431 WP_001295367.1.74444 WP_001295367.1.74445 WP_001295367.1.74478 WP_001295367.1.74491 WP_001295367.1.74501 WP_001295367.1.74509 WP_001295367.1.74513 WP_001295367.1.74520 WP_001295367.1.74528 WP_001295367.1.74532 WP_001295367.1.74549 WP_001295367.1.7461 WP_001295367.1.74624 WP_001295367.1.74625 WP_001295367.1.74652 WP_001295367.1.74670 WP_001295367.1.74687 WP_001295367.1.74689 WP_001295367.1.74691 WP_001295367.1.74705 WP_001295367.1.74713 WP_001295367.1.74735 WP_001295367.1.7475 WP_001295367.1.74752 WP_001295367.1.7478 WP_001295367.1.74844 WP_001295367.1.74852 WP_001295367.1.74854 WP_001295367.1.74860 WP_001295367.1.74885 WP_001295367.1.74889 WP_001295367.1.74895 WP_001295367.1.74998 WP_001295367.1.75021 WP_001295367.1.75029 WP_001295367.1.75050 WP_001295367.1.75124 WP_001295367.1.75136 WP_001295367.1.75139 WP_001295367.1.75145 WP_001295367.1.75149 WP_001295367.1.75181 WP_001295367.1.75209 WP_001295367.1.75243 WP_001295367.1.75270 WP_001295367.1.75360 WP_001295367.1.75367 WP_001295367.1.75428 WP_001295367.1.75435 WP_001295367.1.75465 WP_001295367.1.75491 WP_001295367.1.75505 WP_001295367.1.75537 WP_001295367.1.75588 WP_001295367.1.75594 WP_001295367.1.75653 WP_001295367.1.75672 WP_001295367.1.75676 WP_001295367.1.75679 WP_001295367.1.75687 WP_001295367.1.75696 WP_001295367.1.75735 WP_001295367.1.75758 WP_001295367.1.75853 WP_001295367.1.75973 WP_001295367.1.75995 WP_001295367.1.75999 WP_001295367.1.76009 WP_001295367.1.76039 WP_001295367.1.76087 WP_001295367.1.76119 WP_001295367.1.76129 WP_001295367.1.7617 WP_001295367.1.76184 WP_001295367.1.76196 WP_001295367.1.76211 WP_001295367.1.76305 WP_001295367.1.76312 WP_001295367.1.76361 WP_001295367.1.76376 WP_001295367.1.76384 WP_001295367.1.76387 WP_001295367.1.76446 WP_001295367.1.76447 WP_001295367.1.76460 WP_001295367.1.76462 WP_001295367.1.76542 WP_001295367.1.76547 WP_001295367.1.76595 WP_001295367.1.7661 WP_001295367.1.76656 WP_001295367.1.76701 WP_001295367.1.76815 WP_001295367.1.76909 WP_001295367.1.76918 WP_001295367.1.76933 WP_001295367.1.76948 WP_001295367.1.76957 WP_001295367.1.76965 WP_001295367.1.76966 WP_001295367.1.77015 WP_001295367.1.77022 WP_001295367.1.77042 WP_001295367.1.77070 WP_001295367.1.77109 WP_001295367.1.77162 WP_001295367.1.77163 WP_001295367.1.77175 WP_001295367.1.77198 WP_001295367.1.77214 WP_001295367.1.77255 WP_001295367.1.77258 WP_001295367.1.7728 WP_001295367.1.77284 WP_001295367.1.77291 WP_001295367.1.77341 WP_001295367.1.77358 WP_001295367.1.77437 WP_001295367.1.77452 WP_001295367.1.77462 WP_001295367.1.77470 WP_001295367.1.77477 WP_001295367.1.77503 WP_001295367.1.77581 WP_001295367.1.77595 WP_001295367.1.77608 WP_001295367.1.77626 WP_001295367.1.77636 WP_001295367.1.77648 WP_001295367.1.77767 WP_001295367.1.77768 WP_001295367.1.7781 WP_001295367.1.77813 WP_001295367.1.77826 WP_001295367.1.77876 WP_001295367.1.77929 WP_001295367.1.77949 WP_001295367.1.77999 WP_001295367.1.78000 WP_001295367.1.78007 WP_001295367.1.7804 WP_001295367.1.78041 WP_001295367.1.7808 WP_001295367.1.78089 WP_001295367.1.78099 WP_001295367.1.78102 WP_001295367.1.78196 WP_001295367.1.78233 WP_001295367.1.78321 WP_001295367.1.78323 WP_001295367.1.78337 WP_001295367.1.78368 WP_001295367.1.78377 WP_001295367.1.78413 WP_001295367.1.78445 WP_001295367.1.78462 WP_001295367.1.7847 WP_001295367.1.78481 WP_001295367.1.78515 WP_001295367.1.78527 WP_001295367.1.78583 WP_001295367.1.78586 WP_001295367.1.78610 WP_001295367.1.78612 WP_001295367.1.78615 WP_001295367.1.78645 WP_001295367.1.78683 WP_001295367.1.78698 WP_001295367.1.78718 WP_001295367.1.78750 WP_001295367.1.78757 WP_001295367.1.78775 WP_001295367.1.78791 WP_001295367.1.7883 WP_001295367.1.78843 WP_001295367.1.78854 WP_001295367.1.78888 WP_001295367.1.78891 WP_001295367.1.78908 WP_001295367.1.78919 WP_001295367.1.78953 WP_001295367.1.7896 WP_001295367.1.78966 WP_001295367.1.7898 WP_001295367.1.78996 WP_001295367.1.79004 WP_001295367.1.7901 WP_001295367.1.79065 WP_001295367.1.79067 WP_001295367.1.79075 WP_001295367.1.79086 WP_001295367.1.79159 WP_001295367.1.79246 WP_001295367.1.79248 WP_001295367.1.79249 WP_001295367.1.79306 WP_001295367.1.79312 WP_001295367.1.79343 WP_001295367.1.79346 WP_001295367.1.79356 WP_001295367.1.79369 WP_001295367.1.7937 WP_001295367.1.79391 WP_001295367.1.79414 WP_001295367.1.79464 WP_001295367.1.79478 WP_001295367.1.79505 WP_001295367.1.79519 WP_001295367.1.79525 WP_001295367.1.79540 WP_001295367.1.79558 WP_001295367.1.79591 WP_001295367.1.79606 WP_001295367.1.79685 WP_001295367.1.79713 WP_001295367.1.79764 WP_001295367.1.79800 WP_001295367.1.79816 WP_001295367.1.79824 WP_001295367.1.79840 WP_001295367.1.7985 WP_001295367.1.7987 WP_001295367.1.79871 WP_001295367.1.79877 WP_001295367.1.79905 WP_001295367.1.79922 WP_001295367.1.7993 WP_001295367.1.79931 WP_001295367.1.79932 WP_001295367.1.79936 WP_001295367.1.79952 WP_001295367.1.79984 WP_001295367.1.80050 WP_001295367.1.80060 WP_001295367.1.80061 WP_001295367.1.8007 WP_001295367.1.80071 WP_001295367.1.8011 WP_001295367.1.80112 WP_001295367.1.80136 WP_001295367.1.80141 WP_001295367.1.80179 WP_001295367.1.80183 WP_001295367.1.80255 WP_001295367.1.80310 WP_001295367.1.80320 WP_001295367.1.80428 WP_001295367.1.80440 WP_001295367.1.80444 WP_001295367.1.80463 WP_001295367.1.80484 WP_001295367.1.80517 WP_001295367.1.8057 WP_001295367.1.80577 WP_001295367.1.80612 WP_001295367.1.80626 WP_001295367.1.80662 WP_001295367.1.80666 WP_001295367.1.80709 WP_001295367.1.80724 WP_001295367.1.80753 WP_001295367.1.80754 WP_001295367.1.80756 WP_001295367.1.80768 WP_001295367.1.80789 WP_001295367.1.80804 WP_001295367.1.80884 WP_001295367.1.8090 WP_001295367.1.80935 WP_001295367.1.80945 WP_001295367.1.80946 WP_001295367.1.80966 WP_001295367.1.80983 WP_001295367.1.80985 WP_001295367.1.810 WP_001295367.1.81026 WP_001295367.1.81034 WP_001295367.1.811 WP_001295367.1.81104 WP_001295367.1.81127 WP_001295367.1.81165 WP_001295367.1.8118 WP_001295367.1.81182 WP_001295367.1.8121 WP_001295367.1.8129 WP_001295367.1.81313 WP_001295367.1.81316 WP_001295367.1.81391 WP_001295367.1.81438 WP_001295367.1.81469 WP_001295367.1.81475 WP_001295367.1.81484 WP_001295367.1.81517 WP_001295367.1.81577 WP_001295367.1.81580 WP_001295367.1.81589 WP_001295367.1.81596 WP_001295367.1.81618 WP_001295367.1.81625 WP_001295367.1.81715 WP_001295367.1.8172 WP_001295367.1.81806 WP_001295367.1.8183 WP_001295367.1.81832 WP_001295367.1.81869 WP_001295367.1.81876 WP_001295367.1.81914 WP_001295367.1.81935 WP_001295367.1.81939 WP_001295367.1.81972 WP_001295367.1.82 WP_001295367.1.82062 WP_001295367.1.82074 WP_001295367.1.82137 WP_001295367.1.82217 WP_001295367.1.82240 WP_001295367.1.82242 WP_001295367.1.82246 WP_001295367.1.82275 WP_001295367.1.82316 WP_001295367.1.8235 WP_001295367.1.82485 WP_001295367.1.82507 WP_001295367.1.82514 WP_001295367.1.82536 WP_001295367.1.82572 WP_001295367.1.82626 WP_001295367.1.82647 WP_001295367.1.82691 WP_001295367.1.82700 WP_001295367.1.82715 WP_001295367.1.82718 WP_001295367.1.82754 WP_001295367.1.8277 WP_001295367.1.82784 WP_001295367.1.82799 WP_001295367.1.82831 WP_001295367.1.82833 WP_001295367.1.82991 WP_001295367.1.83020 WP_001295367.1.83035 WP_001295367.1.8306 WP_001295367.1.8308 WP_001295367.1.83093 WP_001295367.1.831 WP_001295367.1.83140 WP_001295367.1.83144 WP_001295367.1.83151 WP_001295367.1.83205 WP_001295367.1.83224 WP_001295367.1.83286 WP_001295367.1.83321 WP_001295367.1.83340 WP_001295367.1.83347 WP_001295367.1.83415 WP_001295367.1.8345 WP_001295367.1.83537 WP_001295367.1.83544 WP_001295367.1.83564 WP_001295367.1.83584 WP_001295367.1.83684 WP_001295367.1.83735 WP_001295367.1.83781 WP_001295367.1.83820 WP_001295367.1.83879 WP_001295367.1.83941 WP_001295367.1.84004 WP_001295367.1.84060 WP_001295367.1.8411 WP_001295367.1.84140 WP_001295367.1.84164 WP_001295367.1.84172 WP_001295367.1.84185 WP_001295367.1.84210 WP_001295367.1.84298 WP_001295367.1.84313 WP_001295367.1.84331 WP_001295367.1.84339 WP_001295367.1.84348 WP_001295367.1.84405 WP_001295367.1.84410 WP_001295367.1.8444 WP_001295367.1.84467 WP_001295367.1.84484 WP_001295367.1.84511 WP_001295367.1.84534 WP_001295367.1.84584 WP_001295367.1.84656 WP_001295367.1.8470 WP_001295367.1.84738 WP_001295367.1.84740 WP_001295367.1.84784 WP_001295367.1.84841 WP_001295367.1.84850 WP_001295367.1.84875 WP_001295367.1.84877 WP_001295367.1.84881 WP_001295367.1.84894 WP_001295367.1.84929 WP_001295367.1.84941 WP_001295367.1.84972 WP_001295367.1.84977 WP_001295367.1.84986 WP_001295367.1.84989 WP_001295367.1.84990 WP_001295367.1.84994 WP_001295367.1.85002 WP_001295367.1.85008 WP_001295367.1.85011 WP_001295367.1.85052 WP_001295367.1.85090 WP_001295367.1.85098 WP_001295367.1.85105 WP_001295367.1.85106 WP_001295367.1.85112 WP_001295367.1.85129 WP_001295367.1.85175 WP_001295367.1.85216 WP_001295367.1.85247 WP_001295367.1.85255 WP_001295367.1.85260 WP_001295367.1.85310 WP_001295367.1.85323 WP_001295367.1.85416 WP_001295367.1.85435 WP_001295367.1.85500 WP_001295367.1.8560 WP_001295367.1.85621 WP_001295367.1.8564 WP_001295367.1.85657 WP_001295367.1.85752 WP_001295367.1.85762 WP_001295367.1.85773 WP_001295367.1.8579 WP_001295367.1.85806 WP_001295367.1.8592 WP_001295367.1.85939 WP_001295367.1.85944 WP_001295367.1.85948 WP_001295367.1.85969 WP_001295367.1.86001 WP_001295367.1.86016 WP_001295367.1.86035 WP_001295367.1.8607 WP_001295367.1.86110 WP_001295367.1.86149 WP_001295367.1.86176 WP_001295367.1.86189 WP_001295367.1.8621 WP_001295367.1.86210 WP_001295367.1.86227 WP_001295367.1.86228 WP_001295367.1.86234 WP_001295367.1.86266 WP_001295367.1.86276 WP_001295367.1.86283 WP_001295367.1.86307 WP_001295367.1.86355 WP_001295367.1.86364 WP_001295367.1.86371 WP_001295367.1.86376 WP_001295367.1.86393 WP_001295367.1.86411 WP_001295367.1.86412 WP_001295367.1.86437 WP_001295367.1.86451 WP_001295367.1.86452 WP_001295367.1.86454 WP_001295367.1.86461 WP_001295367.1.86475 WP_001295367.1.86483 WP_001295367.1.8652 WP_001295367.1.86583 WP_001295367.1.86598 WP_001295367.1.86609 WP_001295367.1.86617 WP_001295367.1.86640 WP_001295367.1.86667 WP_001295367.1.86691 WP_001295367.1.86707 WP_001295367.1.86717 WP_001295367.1.86760 WP_001295367.1.86787 WP_001295367.1.86833 WP_001295367.1.86848 WP_001295367.1.8687 WP_001295367.1.86956 WP_001295367.1.86959 WP_001295367.1.87075 WP_001295367.1.87109 WP_001295367.1.8711 WP_001295367.1.87147 WP_001295367.1.87189 WP_001295367.1.87199 WP_001295367.1.87249 WP_001295367.1.87310 WP_001295367.1.87358 WP_001295367.1.87389 WP_001295367.1.87400 WP_001295367.1.87410 WP_001295367.1.87465 WP_001295367.1.87557 WP_001295367.1.87563 WP_001295367.1.87568 WP_001295367.1.87574 WP_001295367.1.87607 WP_001295367.1.87610 WP_001295367.1.87655 WP_001295367.1.87694 WP_001295367.1.87721 WP_001295367.1.87726 WP_001295367.1.87789 WP_001295367.1.87822 WP_001295367.1.87834 WP_001295367.1.87914 WP_001295367.1.87973 WP_001295367.1.87976 WP_001295367.1.87980 WP_001295367.1.87989 WP_001295367.1.88017 WP_001295367.1.88020 WP_001295367.1.88088 WP_001295367.1.88110 WP_001295367.1.88149 WP_001295367.1.88155 WP_001295367.1.88238 WP_001295367.1.88285 WP_001295367.1.88301 WP_001295367.1.88304 WP_001295367.1.88376 WP_001295367.1.88379 WP_001295367.1.88427 WP_001295367.1.88434 WP_001295367.1.88462 WP_001295367.1.8848 WP_001295367.1.88505 WP_001295367.1.88535 WP_001295367.1.88557 WP_001295367.1.88598 WP_001295367.1.88603 WP_001295367.1.88607 WP_001295367.1.88631 WP_001295367.1.88646 WP_001295367.1.88667 WP_001295367.1.88710 WP_001295367.1.88711 WP_001295367.1.88729 WP_001295367.1.88735 WP_001295367.1.88757 WP_001295367.1.8879 WP_001295367.1.88834 WP_001295367.1.88880 WP_001295367.1.88883 WP_001295367.1.88950 WP_001295367.1.88953 WP_001295367.1.88961 WP_001295367.1.88997 WP_001295367.1.8906 WP_001295367.1.89067 WP_001295367.1.89099 WP_001295367.1.89163 WP_001295367.1.89165 WP_001295367.1.89197 WP_001295367.1.89200 WP_001295367.1.89305 WP_001295367.1.894 WP_001295367.1.89416 WP_001295367.1.89432 WP_001295367.1.8945 WP_001295367.1.89458 WP_001295367.1.89468 WP_001295367.1.89471 WP_001295367.1.89479 WP_001295367.1.89492 WP_001295367.1.89601 WP_001295367.1.89630 WP_001295367.1.89674 WP_001295367.1.89679 WP_001295367.1.89710 WP_001295367.1.89768 WP_001295367.1.89788 WP_001295367.1.89818 WP_001295367.1.89839 WP_001295367.1.8985 WP_001295367.1.89859 WP_001295367.1.89895 WP_001295367.1.89899 WP_001295367.1.89915 WP_001295367.1.89918 WP_001295367.1.89920 WP_001295367.1.89923 WP_001295367.1.89927 WP_001295367.1.89977 WP_001295367.1.89998 WP_001295367.1.90017 WP_001295367.1.90065 WP_001295367.1.90078 WP_001295367.1.9009 WP_001295367.1.9010 WP_001295367.1.90128 WP_001295367.1.90146 WP_001295367.1.90205 WP_001295367.1.90266 WP_001295367.1.90270 WP_001295367.1.90314 WP_001295367.1.90332 WP_001295367.1.90358 WP_001295367.1.9036 WP_001295367.1.90389 WP_001295367.1.90441 WP_001295367.1.90511 WP_001295367.1.90520 WP_001295367.1.90525 WP_001295367.1.90536 WP_001295367.1.90547 WP_001295367.1.9059 WP_001295367.1.90591 WP_001295367.1.9061 WP_001295367.1.90626 WP_001295367.1.90703 WP_001295367.1.90799 WP_001295367.1.9081 WP_001295367.1.90813 WP_001295367.1.90828 WP_001295367.1.90839 WP_001295367.1.90856 WP_001295367.1.90864 WP_001295367.1.90865 WP_001295367.1.90873 WP_001295367.1.90890 WP_001295367.1.90924 WP_001295367.1.90951 WP_001295367.1.90979 WP_001295367.1.91 WP_001295367.1.91018 WP_001295367.1.9104 WP_001295367.1.91121 WP_001295367.1.91170 WP_001295367.1.91266 WP_001295367.1.91268 WP_001295367.1.91277 WP_001295367.1.91290 WP_001295367.1.91340 WP_001295367.1.91341 WP_001295367.1.91397 WP_001295367.1.91462 WP_001295367.1.91485 WP_001295367.1.91511 WP_001295367.1.91551 WP_001295367.1.91565 WP_001295367.1.9157 WP_001295367.1.91596 WP_001295367.1.91640 WP_001295367.1.91672 WP_001295367.1.91685 WP_001295367.1.9169 WP_001295367.1.9171 WP_001295367.1.91777 WP_001295367.1.91782 WP_001295367.1.91787 WP_001295367.1.91850 WP_001295367.1.91951 WP_001295367.1.91959 WP_001295367.1.91971 WP_001295367.1.9199 WP_001295367.1.92014 WP_001295367.1.92019 WP_001295367.1.92048 WP_001295367.1.92102 WP_001295367.1.92123 WP_001295367.1.9215 WP_001295367.1.92161 WP_001295367.1.92180 WP_001295367.1.92215 WP_001295367.1.92224 WP_001295367.1.92305 WP_001295367.1.92311 WP_001295367.1.92323 WP_001295367.1.92361 WP_001295367.1.92434 WP_001295367.1.92496 WP_001295367.1.92532 WP_001295367.1.9255 WP_001295367.1.92568 WP_001295367.1.92577 WP_001295367.1.92614 WP_001295367.1.92615 WP_001295367.1.92634 WP_001295367.1.92638 WP_001295367.1.9264 WP_001295367.1.9266 WP_001295367.1.92668 WP_001295367.1.92693 WP_001295367.1.92708 WP_001295367.1.92719 WP_001295367.1.92742 WP_001295367.1.92750 WP_001295367.1.92780 WP_001295367.1.92781 WP_001295367.1.92792 WP_001295367.1.92845 WP_001295367.1.92865 WP_001295367.1.92943 WP_001295367.1.92953 WP_001295367.1.92989 WP_001295367.1.93005 WP_001295367.1.93016 WP_001295367.1.93019 WP_001295367.1.93023 WP_001295367.1.93048 WP_001295367.1.93054 WP_001295367.1.93072 WP_001295367.1.93100 WP_001295367.1.93150 WP_001295367.1.93175 WP_001295367.1.93252 WP_001295367.1.93276 WP_001295367.1.93309 WP_001295367.1.93312 WP_001295367.1.93338 WP_001295367.1.93388 WP_001295367.1.93463 WP_001295367.1.93509 WP_001295367.1.93605 WP_001295367.1.93621 WP_001295367.1.93629 WP_001295367.1.93634 WP_001295367.1.93637 WP_001295367.1.93652 WP_001295367.1.93673 WP_001295367.1.93733 WP_001295367.1.93737 WP_001295367.1.93743 WP_001295367.1.93745 WP_001295367.1.93755 WP_001295367.1.93768 WP_001295367.1.93800 WP_001295367.1.93873 WP_001295367.1.93877 WP_001295367.1.93911 WP_001295367.1.93918 WP_001295367.1.93971 WP_001295367.1.94008 WP_001295367.1.94011 WP_001295367.1.94025 WP_001295367.1.94057 WP_001295367.1.94156 WP_001295367.1.9416 WP_001295367.1.94176 WP_001295367.1.94232 WP_001295367.1.94271 WP_001295367.1.94298 WP_001295367.1.94317 WP_001295367.1.94353 WP_001295367.1.94388 WP_001295367.1.94404 WP_001295367.1.94430 WP_001295367.1.94445 WP_001295367.1.94468 WP_001295367.1.94507 WP_001295367.1.94548 WP_001295367.1.9457 WP_001295367.1.94578 WP_001295367.1.94626 WP_001295367.1.94695 WP_001295367.1.94738 WP_001295367.1.94764 WP_001295367.1.94787 WP_001295367.1.948 WP_001295367.1.94808 WP_001295367.1.94822 WP_001295367.1.94847 WP_001295367.1.94880 WP_001295367.1.94889 WP_001295367.1.9489 WP_001295367.1.94903 WP_001295367.1.9491 WP_001295367.1.94934 WP_001295367.1.94938 WP_001295367.1.94949 WP_001295367.1.95005 WP_001295367.1.95037 WP_001295367.1.9513 WP_001295367.1.95161 WP_001295367.1.95198 WP_001295367.1.95243 WP_001295367.1.95244 WP_001295367.1.95254 WP_001295367.1.95332 WP_001295367.1.95368 WP_001295367.1.95381 WP_001295367.1.95390 WP_001295367.1.95395 WP_001295367.1.95400 WP_001295367.1.95424 WP_001295367.1.95438 WP_001295367.1.95490 WP_001295367.1.95518 WP_001295367.1.95521 WP_001295367.1.95563 WP_001295367.1.9559 WP_001295367.1.95595 WP_001295367.1.95604 WP_001295367.1.95611 WP_001295367.1.95655 WP_001295367.1.95712 WP_001295367.1.95771 WP_001295367.1.95800 WP_001295367.1.95801 WP_001295367.1.95824 WP_001295367.1.95827 WP_001295367.1.95849 WP_001295367.1.95865 WP_001295367.1.95869 WP_001295367.1.95916 WP_001295367.1.95919 WP_001295367.1.95931 WP_001295367.1.95932 WP_001295367.1.95951 WP_001295367.1.960 WP_001295367.1.96015 WP_001295367.1.96053 WP_001295367.1.96066 WP_001295367.1.96110 WP_001295367.1.96114 WP_001295367.1.96128 WP_001295367.1.96177 WP_001295367.1.96215 WP_001295367.1.96222 WP_001295367.1.96229 WP_001295367.1.96247 WP_001295367.1.96278 WP_001295367.1.96279 WP_001295367.1.96281 WP_001295367.1.96290 WP_001295367.1.96299 WP_001295367.1.96303 WP_001295367.1.9631 WP_001295367.1.96339 WP_001295367.1.96341 WP_001295367.1.96378 WP_001295367.1.96394 WP_001295367.1.96417 WP_001295367.1.96457 WP_001295367.1.96479 WP_001295367.1.96494 WP_001295367.1.965 WP_001295367.1.96541 WP_001295367.1.9657 WP_001295367.1.96585 WP_001295367.1.96608 WP_001295367.1.9661 WP_001295367.1.96680 WP_001295367.1.96743 WP_001295367.1.96769 WP_001295367.1.96817 WP_001295367.1.96894 WP_001295367.1.9690 WP_001295367.1.9691 WP_001295367.1.96924 WP_001295367.1.96932 WP_001295367.1.96936 WP_001295367.1.96944 WP_001295367.1.96971 WP_001295367.1.96984 WP_001295367.1.97011 WP_001295367.1.97027 WP_001295367.1.97049 WP_001295367.1.97059 WP_001295367.1.97119 WP_001295367.1.97123 WP_001295367.1.97160 WP_001295367.1.97170 WP_001295367.1.97200 WP_001295367.1.97238 WP_001295367.1.97248 WP_001295367.1.97279 WP_001295367.1.97344 WP_001295367.1.97356 WP_001295367.1.97360 WP_001295367.1.97361 WP_001295367.1.97418 WP_001295367.1.97421 WP_001295367.1.97434 WP_001295367.1.97439 WP_001295367.1.9747 WP_001295367.1.97490 WP_001295367.1.97502 WP_001295367.1.97538 WP_001295367.1.97544 WP_001295367.1.97560 WP_001295367.1.97667 WP_001295367.1.97677 WP_001295367.1.97685 WP_001295367.1.97705 WP_001295367.1.97798 WP_001295367.1.978 WP_001295367.1.97815 WP_001295367.1.97822 WP_001295367.1.97825 WP_001295367.1.97930 WP_001295367.1.97932 WP_001295367.1.97937 WP_001295367.1.97962 WP_001295367.1.97996 WP_001295367.1.98005 WP_001295367.1.98012 WP_001295367.1.98026 WP_001295367.1.9803 WP_001295367.1.98082 WP_001295367.1.98115 WP_001295367.1.9816 WP_001295367.1.98232 WP_001295367.1.98235 WP_001295367.1.98241 WP_001295367.1.98244 WP_001295367.1.98292 WP_001295367.1.98294 WP_001295367.1.98301 WP_001295367.1.98323 WP_001295367.1.98355 WP_001295367.1.98357 WP_001295367.1.98424 WP_001295367.1.9844 WP_001295367.1.98442 WP_001295367.1.98451 WP_001295367.1.98477 WP_001295367.1.98549 WP_001295367.1.98578 WP_001295367.1.9858 WP_001295367.1.98614 WP_001295367.1.98628 WP_001295367.1.98654 WP_001295367.1.98683 WP_001295367.1.98702 WP_001295367.1.98776 WP_001295367.1.98784 WP_001295367.1.98795 WP_001295367.1.98875 WP_001295367.1.99046 WP_001295367.1.99119 WP_001295367.1.99209 WP_001295367.1.99246 WP_001295367.1.99265 WP_001295367.1.99292 WP_001295367.1.99295 WP_001295367.1.99304 WP_001295367.1.99310 WP_001295367.1.99319 WP_001295367.1.99334 WP_001295367.1.99345 WP_001295367.1.9935 WP_001295367.1.99361 WP_001295367.1.99366 WP_001295367.1.99392 WP_001295367.1.9940 WP_001295367.1.99400 WP_001295367.1.99446 WP_001295367.1.99453 WP_001295367.1.99511 WP_001295367.1.99534 WP_001295367.1.99562 WP_001295367.1.99592 WP_001295367.1.99602 WP_001295367.1.99603 WP_001295367.1.99619 WP_001295367.1.99632 WP_001295367.1.99666 WP_001295367.1.99734 WP_001295367.1.99804 WP_001295367.1.99827 WP_001295367.1.99869 WP_001295367.1.99929 YP_006778032.1.12065 gi|388478595|ref|YP_490787.1| gi|218696186|ref|YP_002403853.1| gi|30063946|ref|NP_838117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]