SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209921373|ref|YP_002295457.1| from Escherichia coli SE11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209921373|ref|YP_002295457.1|
Domain Number 1 Region: 22-275
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.63e-82
Family FdhD/NarQ 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209921373|ref|YP_002295457.1|
Sequence length 277
Comment formate dehydrogenase accessory protein [Escherichia coli SE11]
Sequence
MKKTQQKEIENVTNITGVRQIELWRRDDLQHPRLDEVAEEVPVALVYNGISHVVMMASPK
DLEYFALGFSLSEGIIESPRDIFGMDVVPSCNGLEVQIELSSRRFMGLKERRRALAGRTG
CGVCGVEQLNDIGKPVQPLPFTQTFDLNKLDDALRHLNDFQPVGQLTGCTHAAAWMLPSG
ELVGGHEDVGRHVALDKLLGRRSQEGESWQQGAVLVSSRASYEMVQKSAMCGVEILFAVS
AATTLAVEVAERCNLTLVGFCKPGRATVYTHPQRLSN
Download sequence
Identical sequences A0A026V038 A0A027TPC3 A0A028AP02 A0A028E1S8 A0A064T0D0 A0A070FCS2 A0A0A8UJJ8 A0A0E0VDU3 A0A0E0Y7H7 A0A0E2LD76 A0A0E2TN11 A0A0F6CBK5 A0A0F6FF09 A0A192CEV7 A0A1E3N240 A0A1S6TJ43 A0A1X3HZ91 A0A1X3IU25 A0A1X3LA60 A0A1Z3UWV0 A0A222QST1 A0A237BMX0 A0A237G013 A0A2H1BJF1 A1AI75 B5YZ31 B6I4N6 B7L9F1 B7MI29 B7MQY8 B7NFJ6 B7NUB4 C3SJC7 C8TZG6 C8UKF5 D3QY93 D6I3E6 D6IGC5 D6JHL3 D7X2B4 E1IUG0 E9TAM1 F4V8K8 K4VMF8 K4W2B6 L3Q8S6 Q1R420 Q8X8B5 T5ZUC3 T9T9U0 U9XIR1 U9ZZA1 V0V340 V8FNT3 V8KDW1 W9AN00
gi|218697610|ref|YP_002405277.1| gi|544578451|ref|YP_008573975.1| 155864.Z5438 364106.UTI89_C4482 386585.ECs4821 405955.APECO1_2570 409438.ECSE_4182 444450.ECH74115_5346 544404.ECSP_4954 573235.ECO26_4691 585035.ECS88_4344 585055.EC55989_4373 585056.ECUMN_4426 585057.ECIAI39_3103 585395.ECO103_4632 585396.ECO111_4718 585397.ECED1_4599 gi|410484920|ref|YP_006772466.1| FDHD_ECO57 gi|291285308|ref|YP_003502126.1| gi|15834075|ref|NP_312848.1| gi|117626166|ref|YP_859489.1| gi|260857703|ref|YP_003231594.1| gi|260846684|ref|YP_003224462.1| gi|254795891|ref|YP_003080728.1| gi|260870614|ref|YP_003237016.1| gi|407466901|ref|YP_006786657.1| gi|15804484|ref|NP_290524.1| gi|91213439|ref|YP_543425.1| NP_312848.1.58667 WP_000753589.1.1000 WP_000753589.1.10001 WP_000753589.1.100014 WP_000753589.1.100073 WP_000753589.1.10010 WP_000753589.1.100138 WP_000753589.1.100185 WP_000753589.1.100194 WP_000753589.1.100220 WP_000753589.1.100227 WP_000753589.1.100252 WP_000753589.1.100281 WP_000753589.1.100283 WP_000753589.1.100285 WP_000753589.1.100299 WP_000753589.1.100302 WP_000753589.1.100304 WP_000753589.1.100425 WP_000753589.1.100474 WP_000753589.1.100499 WP_000753589.1.100508 WP_000753589.1.100543 WP_000753589.1.100554 WP_000753589.1.100571 WP_000753589.1.10067 WP_000753589.1.10068 WP_000753589.1.100718 WP_000753589.1.100735 WP_000753589.1.100738 WP_000753589.1.100752 WP_000753589.1.100778 WP_000753589.1.100796 WP_000753589.1.10080 WP_000753589.1.100836 WP_000753589.1.100867 WP_000753589.1.100898 WP_000753589.1.100916 WP_000753589.1.100925 WP_000753589.1.100933 WP_000753589.1.10100 WP_000753589.1.101087 WP_000753589.1.101096 WP_000753589.1.1011 WP_000753589.1.101102 WP_000753589.1.101105 WP_000753589.1.101148 WP_000753589.1.101157 WP_000753589.1.101166 WP_000753589.1.101206 WP_000753589.1.101216 WP_000753589.1.101255 WP_000753589.1.101257 WP_000753589.1.10126 WP_000753589.1.101289 WP_000753589.1.101293 WP_000753589.1.101359 WP_000753589.1.101399 WP_000753589.1.101429 WP_000753589.1.101430 WP_000753589.1.101436 WP_000753589.1.101445 WP_000753589.1.101468 WP_000753589.1.101518 WP_000753589.1.10154 WP_000753589.1.101583 WP_000753589.1.101628 WP_000753589.1.101630 WP_000753589.1.101651 WP_000753589.1.101653 WP_000753589.1.101668 WP_000753589.1.101686 WP_000753589.1.101786 WP_000753589.1.101822 WP_000753589.1.10184 WP_000753589.1.101840 WP_000753589.1.101845 WP_000753589.1.101855 WP_000753589.1.10190 WP_000753589.1.101913 WP_000753589.1.101926 WP_000753589.1.101932 WP_000753589.1.101947 WP_000753589.1.101948 WP_000753589.1.101952 WP_000753589.1.101969 WP_000753589.1.101977 WP_000753589.1.101987 WP_000753589.1.10206 WP_000753589.1.102069 WP_000753589.1.102094 WP_000753589.1.102104 WP_000753589.1.102122 WP_000753589.1.102139 WP_000753589.1.102144 WP_000753589.1.10273 WP_000753589.1.10326 WP_000753589.1.10335 WP_000753589.1.10379 WP_000753589.1.10461 WP_000753589.1.10476 WP_000753589.1.10492 WP_000753589.1.10538 WP_000753589.1.10573 WP_000753589.1.10579 WP_000753589.1.10605 WP_000753589.1.10607 WP_000753589.1.10651 WP_000753589.1.10697 WP_000753589.1.10705 WP_000753589.1.1071 WP_000753589.1.1073 WP_000753589.1.1074 WP_000753589.1.10748 WP_000753589.1.10761 WP_000753589.1.10763 WP_000753589.1.10798 WP_000753589.1.10814 WP_000753589.1.10842 WP_000753589.1.10849 WP_000753589.1.10922 WP_000753589.1.10970 WP_000753589.1.10989 WP_000753589.1.10994 WP_000753589.1.11006 WP_000753589.1.11032 WP_000753589.1.11057 WP_000753589.1.11068 WP_000753589.1.11071 WP_000753589.1.11091 WP_000753589.1.1111 WP_000753589.1.11113 WP_000753589.1.11121 WP_000753589.1.11133 WP_000753589.1.112 WP_000753589.1.11217 WP_000753589.1.11240 WP_000753589.1.11250 WP_000753589.1.11265 WP_000753589.1.11301 WP_000753589.1.11315 WP_000753589.1.11399 WP_000753589.1.11420 WP_000753589.1.11524 WP_000753589.1.11531 WP_000753589.1.11578 WP_000753589.1.11607 WP_000753589.1.11612 WP_000753589.1.11616 WP_000753589.1.11671 WP_000753589.1.11690 WP_000753589.1.11699 WP_000753589.1.11748 WP_000753589.1.11801 WP_000753589.1.11949 WP_000753589.1.12009 WP_000753589.1.12010 WP_000753589.1.12030 WP_000753589.1.12051 WP_000753589.1.12076 WP_000753589.1.12115 WP_000753589.1.12151 WP_000753589.1.12259 WP_000753589.1.12279 WP_000753589.1.12305 WP_000753589.1.12320 WP_000753589.1.12344 WP_000753589.1.12352 WP_000753589.1.1242 WP_000753589.1.12459 WP_000753589.1.12478 WP_000753589.1.12552 WP_000753589.1.12566 WP_000753589.1.12574 WP_000753589.1.12645 WP_000753589.1.12646 WP_000753589.1.12693 WP_000753589.1.12697 WP_000753589.1.12717 WP_000753589.1.12743 WP_000753589.1.12749 WP_000753589.1.1275 WP_000753589.1.12831 WP_000753589.1.12876 WP_000753589.1.12893 WP_000753589.1.12911 WP_000753589.1.1295 WP_000753589.1.12956 WP_000753589.1.12976 WP_000753589.1.12991 WP_000753589.1.13060 WP_000753589.1.13117 WP_000753589.1.13162 WP_000753589.1.13205 WP_000753589.1.13217 WP_000753589.1.13222 WP_000753589.1.13223 WP_000753589.1.1323 WP_000753589.1.13295 WP_000753589.1.13301 WP_000753589.1.13332 WP_000753589.1.13348 WP_000753589.1.1335 WP_000753589.1.13393 WP_000753589.1.13430 WP_000753589.1.13442 WP_000753589.1.13481 WP_000753589.1.13525 WP_000753589.1.13601 WP_000753589.1.13791 WP_000753589.1.13881 WP_000753589.1.13924 WP_000753589.1.13934 WP_000753589.1.13936 WP_000753589.1.13944 WP_000753589.1.14042 WP_000753589.1.14062 WP_000753589.1.14110 WP_000753589.1.14304 WP_000753589.1.14331 WP_000753589.1.14389 WP_000753589.1.14398 WP_000753589.1.14417 WP_000753589.1.14432 WP_000753589.1.14453 WP_000753589.1.14493 WP_000753589.1.14508 WP_000753589.1.14509 WP_000753589.1.14538 WP_000753589.1.14601 WP_000753589.1.14605 WP_000753589.1.14621 WP_000753589.1.14672 WP_000753589.1.14687 WP_000753589.1.14693 WP_000753589.1.14712 WP_000753589.1.14746 WP_000753589.1.14748 WP_000753589.1.14749 WP_000753589.1.14934 WP_000753589.1.14956 WP_000753589.1.14977 WP_000753589.1.14993 WP_000753589.1.15020 WP_000753589.1.15041 WP_000753589.1.15087 WP_000753589.1.15090 WP_000753589.1.15138 WP_000753589.1.1524 WP_000753589.1.15300 WP_000753589.1.15335 WP_000753589.1.15356 WP_000753589.1.15416 WP_000753589.1.15444 WP_000753589.1.15464 WP_000753589.1.1550 WP_000753589.1.15503 WP_000753589.1.15521 WP_000753589.1.15527 WP_000753589.1.15528 WP_000753589.1.15583 WP_000753589.1.1559 WP_000753589.1.15593 WP_000753589.1.15600 WP_000753589.1.15624 WP_000753589.1.15626 WP_000753589.1.15654 WP_000753589.1.15702 WP_000753589.1.15731 WP_000753589.1.15782 WP_000753589.1.15791 WP_000753589.1.15809 WP_000753589.1.1582 WP_000753589.1.15855 WP_000753589.1.15857 WP_000753589.1.15863 WP_000753589.1.15906 WP_000753589.1.15916 WP_000753589.1.15945 WP_000753589.1.15951 WP_000753589.1.15983 WP_000753589.1.15984 WP_000753589.1.16034 WP_000753589.1.1604 WP_000753589.1.16067 WP_000753589.1.16075 WP_000753589.1.16117 WP_000753589.1.16133 WP_000753589.1.16171 WP_000753589.1.16183 WP_000753589.1.16194 WP_000753589.1.1621 WP_000753589.1.16222 WP_000753589.1.16272 WP_000753589.1.163 WP_000753589.1.16388 WP_000753589.1.16396 WP_000753589.1.1640 WP_000753589.1.16463 WP_000753589.1.16481 WP_000753589.1.16517 WP_000753589.1.16608 WP_000753589.1.16682 WP_000753589.1.16685 WP_000753589.1.16745 WP_000753589.1.16766 WP_000753589.1.16805 WP_000753589.1.16807 WP_000753589.1.16818 WP_000753589.1.16845 WP_000753589.1.16861 WP_000753589.1.17014 WP_000753589.1.17061 WP_000753589.1.1710 WP_000753589.1.17102 WP_000753589.1.17109 WP_000753589.1.17111 WP_000753589.1.17153 WP_000753589.1.17170 WP_000753589.1.17172 WP_000753589.1.17182 WP_000753589.1.17187 WP_000753589.1.17206 WP_000753589.1.17241 WP_000753589.1.17242 WP_000753589.1.17267 WP_000753589.1.17297 WP_000753589.1.1731 WP_000753589.1.17356 WP_000753589.1.17386 WP_000753589.1.17392 WP_000753589.1.17403 WP_000753589.1.17415 WP_000753589.1.17417 WP_000753589.1.17464 WP_000753589.1.17496 WP_000753589.1.17515 WP_000753589.1.1754 WP_000753589.1.17550 WP_000753589.1.17568 WP_000753589.1.17584 WP_000753589.1.17623 WP_000753589.1.1766 WP_000753589.1.1772 WP_000753589.1.17766 WP_000753589.1.17769 WP_000753589.1.17802 WP_000753589.1.17829 WP_000753589.1.17904 WP_000753589.1.17920 WP_000753589.1.17925 WP_000753589.1.17961 WP_000753589.1.17963 WP_000753589.1.18000 WP_000753589.1.1802 WP_000753589.1.18024 WP_000753589.1.18064 WP_000753589.1.18094 WP_000753589.1.18112 WP_000753589.1.18136 WP_000753589.1.18164 WP_000753589.1.1821 WP_000753589.1.18326 WP_000753589.1.1834 WP_000753589.1.18340 WP_000753589.1.18348 WP_000753589.1.18383 WP_000753589.1.18394 WP_000753589.1.18436 WP_000753589.1.18438 WP_000753589.1.1844 WP_000753589.1.18458 WP_000753589.1.18482 WP_000753589.1.18519 WP_000753589.1.18556 WP_000753589.1.1861 WP_000753589.1.18617 WP_000753589.1.1866 WP_000753589.1.18666 WP_000753589.1.18714 WP_000753589.1.188 WP_000753589.1.18801 WP_000753589.1.1881 WP_000753589.1.18837 WP_000753589.1.18843 WP_000753589.1.18874 WP_000753589.1.18899 WP_000753589.1.18923 WP_000753589.1.18936 WP_000753589.1.18995 WP_000753589.1.19039 WP_000753589.1.1909 WP_000753589.1.191 WP_000753589.1.19140 WP_000753589.1.19146 WP_000753589.1.19147 WP_000753589.1.19153 WP_000753589.1.1925 WP_000753589.1.19276 WP_000753589.1.19297 WP_000753589.1.19312 WP_000753589.1.19314 WP_000753589.1.19332 WP_000753589.1.19350 WP_000753589.1.19379 WP_000753589.1.19397 WP_000753589.1.19419 WP_000753589.1.19424 WP_000753589.1.19448 WP_000753589.1.19494 WP_000753589.1.1952 WP_000753589.1.19534 WP_000753589.1.19544 WP_000753589.1.19547 WP_000753589.1.19557 WP_000753589.1.19581 WP_000753589.1.19583 WP_000753589.1.19593 WP_000753589.1.19649 WP_000753589.1.19661 WP_000753589.1.19760 WP_000753589.1.19830 WP_000753589.1.19840 WP_000753589.1.19847 WP_000753589.1.1987 WP_000753589.1.2005 WP_000753589.1.20114 WP_000753589.1.20129 WP_000753589.1.20159 WP_000753589.1.20166 WP_000753589.1.20238 WP_000753589.1.20251 WP_000753589.1.20264 WP_000753589.1.2027 WP_000753589.1.20277 WP_000753589.1.20289 WP_000753589.1.20325 WP_000753589.1.20334 WP_000753589.1.20449 WP_000753589.1.20480 WP_000753589.1.20483 WP_000753589.1.20493 WP_000753589.1.20546 WP_000753589.1.20594 WP_000753589.1.20630 WP_000753589.1.20662 WP_000753589.1.20709 WP_000753589.1.20741 WP_000753589.1.20745 WP_000753589.1.2075 WP_000753589.1.20761 WP_000753589.1.20765 WP_000753589.1.20784 WP_000753589.1.20785 WP_000753589.1.20824 WP_000753589.1.20841 WP_000753589.1.20893 WP_000753589.1.2092 WP_000753589.1.2094 WP_000753589.1.20941 WP_000753589.1.20950 WP_000753589.1.20989 WP_000753589.1.21041 WP_000753589.1.21137 WP_000753589.1.21152 WP_000753589.1.21236 WP_000753589.1.21248 WP_000753589.1.21255 WP_000753589.1.21266 WP_000753589.1.21320 WP_000753589.1.21336 WP_000753589.1.21378 WP_000753589.1.21441 WP_000753589.1.21450 WP_000753589.1.21455 WP_000753589.1.21508 WP_000753589.1.21519 WP_000753589.1.21537 WP_000753589.1.21628 WP_000753589.1.21634 WP_000753589.1.21666 WP_000753589.1.21667 WP_000753589.1.21668 WP_000753589.1.21696 WP_000753589.1.21714 WP_000753589.1.21732 WP_000753589.1.21812 WP_000753589.1.21899 WP_000753589.1.21945 WP_000753589.1.21948 WP_000753589.1.21962 WP_000753589.1.2198 WP_000753589.1.21992 WP_000753589.1.22138 WP_000753589.1.22161 WP_000753589.1.2218 WP_000753589.1.22182 WP_000753589.1.22189 WP_000753589.1.22203 WP_000753589.1.22204 WP_000753589.1.22251 WP_000753589.1.22272 WP_000753589.1.22291 WP_000753589.1.22304 WP_000753589.1.22381 WP_000753589.1.2242 WP_000753589.1.22431 WP_000753589.1.2245 WP_000753589.1.22464 WP_000753589.1.22549 WP_000753589.1.22576 WP_000753589.1.22594 WP_000753589.1.22599 WP_000753589.1.22631 WP_000753589.1.22691 WP_000753589.1.22743 WP_000753589.1.22759 WP_000753589.1.22814 WP_000753589.1.22824 WP_000753589.1.22868 WP_000753589.1.22917 WP_000753589.1.22925 WP_000753589.1.22988 WP_000753589.1.22993 WP_000753589.1.23005 WP_000753589.1.23026 WP_000753589.1.23035 WP_000753589.1.23073 WP_000753589.1.23078 WP_000753589.1.23092 WP_000753589.1.23109 WP_000753589.1.23115 WP_000753589.1.2322 WP_000753589.1.23230 WP_000753589.1.23241 WP_000753589.1.23290 WP_000753589.1.23323 WP_000753589.1.23355 WP_000753589.1.23386 WP_000753589.1.23388 WP_000753589.1.23393 WP_000753589.1.23467 WP_000753589.1.23487 WP_000753589.1.23520 WP_000753589.1.23522 WP_000753589.1.23527 WP_000753589.1.23593 WP_000753589.1.23640 WP_000753589.1.23693 WP_000753589.1.23711 WP_000753589.1.23741 WP_000753589.1.23752 WP_000753589.1.23754 WP_000753589.1.23790 WP_000753589.1.23806 WP_000753589.1.23838 WP_000753589.1.23840 WP_000753589.1.2388 WP_000753589.1.23890 WP_000753589.1.23895 WP_000753589.1.23899 WP_000753589.1.23915 WP_000753589.1.23950 WP_000753589.1.23953 WP_000753589.1.23962 WP_000753589.1.23970 WP_000753589.1.23973 WP_000753589.1.23984 WP_000753589.1.24004 WP_000753589.1.24024 WP_000753589.1.24038 WP_000753589.1.24068 WP_000753589.1.24070 WP_000753589.1.24127 WP_000753589.1.2413 WP_000753589.1.24136 WP_000753589.1.24169 WP_000753589.1.24233 WP_000753589.1.24283 WP_000753589.1.24341 WP_000753589.1.24374 WP_000753589.1.24381 WP_000753589.1.24383 WP_000753589.1.24458 WP_000753589.1.24460 WP_000753589.1.24473 WP_000753589.1.24483 WP_000753589.1.2449 WP_000753589.1.24536 WP_000753589.1.24575 WP_000753589.1.24592 WP_000753589.1.24642 WP_000753589.1.24646 WP_000753589.1.24650 WP_000753589.1.2469 WP_000753589.1.24695 WP_000753589.1.24753 WP_000753589.1.24763 WP_000753589.1.2479 WP_000753589.1.24870 WP_000753589.1.24906 WP_000753589.1.24926 WP_000753589.1.24929 WP_000753589.1.24939 WP_000753589.1.24946 WP_000753589.1.24979 WP_000753589.1.24984 WP_000753589.1.25019 WP_000753589.1.25021 WP_000753589.1.25039 WP_000753589.1.2504 WP_000753589.1.25050 WP_000753589.1.25076 WP_000753589.1.25079 WP_000753589.1.25082 WP_000753589.1.25087 WP_000753589.1.25088 WP_000753589.1.25174 WP_000753589.1.25201 WP_000753589.1.25204 WP_000753589.1.25248 WP_000753589.1.25270 WP_000753589.1.25305 WP_000753589.1.25378 WP_000753589.1.25380 WP_000753589.1.2540 WP_000753589.1.25414 WP_000753589.1.25420 WP_000753589.1.2543 WP_000753589.1.25446 WP_000753589.1.25480 WP_000753589.1.25526 WP_000753589.1.25548 WP_000753589.1.25577 WP_000753589.1.2558 WP_000753589.1.25592 WP_000753589.1.25613 WP_000753589.1.25631 WP_000753589.1.25701 WP_000753589.1.25712 WP_000753589.1.25794 WP_000753589.1.25819 WP_000753589.1.25831 WP_000753589.1.25869 WP_000753589.1.25873 WP_000753589.1.2588 WP_000753589.1.25886 WP_000753589.1.25890 WP_000753589.1.25895 WP_000753589.1.2606 WP_000753589.1.26061 WP_000753589.1.26066 WP_000753589.1.26076 WP_000753589.1.26092 WP_000753589.1.26100 WP_000753589.1.26105 WP_000753589.1.26121 WP_000753589.1.26130 WP_000753589.1.26134 WP_000753589.1.26150 WP_000753589.1.26175 WP_000753589.1.26186 WP_000753589.1.26189 WP_000753589.1.26246 WP_000753589.1.26262 WP_000753589.1.26264 WP_000753589.1.26270 WP_000753589.1.26304 WP_000753589.1.26325 WP_000753589.1.26331 WP_000753589.1.2637 WP_000753589.1.2642 WP_000753589.1.26438 WP_000753589.1.26474 WP_000753589.1.26479 WP_000753589.1.26525 WP_000753589.1.26574 WP_000753589.1.26590 WP_000753589.1.26598 WP_000753589.1.26613 WP_000753589.1.26627 WP_000753589.1.26658 WP_000753589.1.26659 WP_000753589.1.26683 WP_000753589.1.26716 WP_000753589.1.26720 WP_000753589.1.26736 WP_000753589.1.26761 WP_000753589.1.26782 WP_000753589.1.26839 WP_000753589.1.26878 WP_000753589.1.26912 WP_000753589.1.26932 WP_000753589.1.2695 WP_000753589.1.26950 WP_000753589.1.26975 WP_000753589.1.26987 WP_000753589.1.26995 WP_000753589.1.26998 WP_000753589.1.27019 WP_000753589.1.27043 WP_000753589.1.27060 WP_000753589.1.27091 WP_000753589.1.27148 WP_000753589.1.27234 WP_000753589.1.27292 WP_000753589.1.2731 WP_000753589.1.27310 WP_000753589.1.27330 WP_000753589.1.27338 WP_000753589.1.27396 WP_000753589.1.27401 WP_000753589.1.27424 WP_000753589.1.27445 WP_000753589.1.27518 WP_000753589.1.27524 WP_000753589.1.27580 WP_000753589.1.27691 WP_000753589.1.27693 WP_000753589.1.27698 WP_000753589.1.27723 WP_000753589.1.27741 WP_000753589.1.2779 WP_000753589.1.27846 WP_000753589.1.27856 WP_000753589.1.27861 WP_000753589.1.27897 WP_000753589.1.27913 WP_000753589.1.27932 WP_000753589.1.2794 WP_000753589.1.27998 WP_000753589.1.28026 WP_000753589.1.28027 WP_000753589.1.28051 WP_000753589.1.28102 WP_000753589.1.28109 WP_000753589.1.28143 WP_000753589.1.28156 WP_000753589.1.28184 WP_000753589.1.2823 WP_000753589.1.28250 WP_000753589.1.2826 WP_000753589.1.28305 WP_000753589.1.28322 WP_000753589.1.28349 WP_000753589.1.2838 WP_000753589.1.28461 WP_000753589.1.28476 WP_000753589.1.28480 WP_000753589.1.285 WP_000753589.1.28523 WP_000753589.1.28551 WP_000753589.1.28554 WP_000753589.1.28639 WP_000753589.1.28683 WP_000753589.1.28734 WP_000753589.1.28742 WP_000753589.1.2881 WP_000753589.1.28829 WP_000753589.1.28842 WP_000753589.1.28863 WP_000753589.1.28879 WP_000753589.1.28950 WP_000753589.1.28953 WP_000753589.1.29001 WP_000753589.1.29049 WP_000753589.1.29082 WP_000753589.1.291 WP_000753589.1.29126 WP_000753589.1.29150 WP_000753589.1.29176 WP_000753589.1.29194 WP_000753589.1.29206 WP_000753589.1.29394 WP_000753589.1.29404 WP_000753589.1.29429 WP_000753589.1.29486 WP_000753589.1.29495 WP_000753589.1.29497 WP_000753589.1.29503 WP_000753589.1.29504 WP_000753589.1.29513 WP_000753589.1.29523 WP_000753589.1.2954 WP_000753589.1.29564 WP_000753589.1.29590 WP_000753589.1.29597 WP_000753589.1.29618 WP_000753589.1.29662 WP_000753589.1.29669 WP_000753589.1.29724 WP_000753589.1.2978 WP_000753589.1.29798 WP_000753589.1.29815 WP_000753589.1.29818 WP_000753589.1.29820 WP_000753589.1.29840 WP_000753589.1.29876 WP_000753589.1.29976 WP_000753589.1.29979 WP_000753589.1.29988 WP_000753589.1.30 WP_000753589.1.30019 WP_000753589.1.30035 WP_000753589.1.30052 WP_000753589.1.30063 WP_000753589.1.30064 WP_000753589.1.30098 WP_000753589.1.30105 WP_000753589.1.30123 WP_000753589.1.30164 WP_000753589.1.3018 WP_000753589.1.30239 WP_000753589.1.30269 WP_000753589.1.30298 WP_000753589.1.30391 WP_000753589.1.30399 WP_000753589.1.30428 WP_000753589.1.30452 WP_000753589.1.30476 WP_000753589.1.3055 WP_000753589.1.30570 WP_000753589.1.306 WP_000753589.1.30637 WP_000753589.1.30665 WP_000753589.1.30733 WP_000753589.1.30742 WP_000753589.1.30808 WP_000753589.1.30853 WP_000753589.1.30867 WP_000753589.1.30879 WP_000753589.1.30896 WP_000753589.1.30905 WP_000753589.1.30906 WP_000753589.1.30918 WP_000753589.1.30993 WP_000753589.1.30999 WP_000753589.1.31009 WP_000753589.1.31017 WP_000753589.1.31055 WP_000753589.1.31149 WP_000753589.1.31154 WP_000753589.1.31188 WP_000753589.1.312 WP_000753589.1.31252 WP_000753589.1.31295 WP_000753589.1.31319 WP_000753589.1.31340 WP_000753589.1.31347 WP_000753589.1.31357 WP_000753589.1.3140 WP_000753589.1.31401 WP_000753589.1.31422 WP_000753589.1.3147 WP_000753589.1.31511 WP_000753589.1.31518 WP_000753589.1.31521 WP_000753589.1.31542 WP_000753589.1.31557 WP_000753589.1.31559 WP_000753589.1.31575 WP_000753589.1.31618 WP_000753589.1.31709 WP_000753589.1.31715 WP_000753589.1.31740 WP_000753589.1.31803 WP_000753589.1.31809 WP_000753589.1.31823 WP_000753589.1.31825 WP_000753589.1.31835 WP_000753589.1.31863 WP_000753589.1.31866 WP_000753589.1.31924 WP_000753589.1.3193 WP_000753589.1.31956 WP_000753589.1.32020 WP_000753589.1.32021 WP_000753589.1.3203 WP_000753589.1.32030 WP_000753589.1.32037 WP_000753589.1.32063 WP_000753589.1.32089 WP_000753589.1.32142 WP_000753589.1.3215 WP_000753589.1.32184 WP_000753589.1.322 WP_000753589.1.32222 WP_000753589.1.32232 WP_000753589.1.32234 WP_000753589.1.32236 WP_000753589.1.32243 WP_000753589.1.32287 WP_000753589.1.32406 WP_000753589.1.32432 WP_000753589.1.3247 WP_000753589.1.32475 WP_000753589.1.32480 WP_000753589.1.32494 WP_000753589.1.32518 WP_000753589.1.32536 WP_000753589.1.32561 WP_000753589.1.32574 WP_000753589.1.3259 WP_000753589.1.32590 WP_000753589.1.3269 WP_000753589.1.32718 WP_000753589.1.32724 WP_000753589.1.32772 WP_000753589.1.32811 WP_000753589.1.32831 WP_000753589.1.32835 WP_000753589.1.32875 WP_000753589.1.32888 WP_000753589.1.32931 WP_000753589.1.32946 WP_000753589.1.3295 WP_000753589.1.32972 WP_000753589.1.32995 WP_000753589.1.33014 WP_000753589.1.33018 WP_000753589.1.33026 WP_000753589.1.33046 WP_000753589.1.33049 WP_000753589.1.33055 WP_000753589.1.33094 WP_000753589.1.33101 WP_000753589.1.33119 WP_000753589.1.33125 WP_000753589.1.33146 WP_000753589.1.33167 WP_000753589.1.33178 WP_000753589.1.33179 WP_000753589.1.33190 WP_000753589.1.33217 WP_000753589.1.33222 WP_000753589.1.33268 WP_000753589.1.33303 WP_000753589.1.33341 WP_000753589.1.33369 WP_000753589.1.33410 WP_000753589.1.3344 WP_000753589.1.33475 WP_000753589.1.33512 WP_000753589.1.3354 WP_000753589.1.33563 WP_000753589.1.33667 WP_000753589.1.33680 WP_000753589.1.33745 WP_000753589.1.33823 WP_000753589.1.33914 WP_000753589.1.33948 WP_000753589.1.33981 WP_000753589.1.3411 WP_000753589.1.34117 WP_000753589.1.34121 WP_000753589.1.34122 WP_000753589.1.34144 WP_000753589.1.34204 WP_000753589.1.34206 WP_000753589.1.34224 WP_000753589.1.34269 WP_000753589.1.34303 WP_000753589.1.3432 WP_000753589.1.34348 WP_000753589.1.34383 WP_000753589.1.3439 WP_000753589.1.34422 WP_000753589.1.3444 WP_000753589.1.34441 WP_000753589.1.34470 WP_000753589.1.34500 WP_000753589.1.34558 WP_000753589.1.3460 WP_000753589.1.34617 WP_000753589.1.34675 WP_000753589.1.34680 WP_000753589.1.34682 WP_000753589.1.34686 WP_000753589.1.3472 WP_000753589.1.34781 WP_000753589.1.34794 WP_000753589.1.34835 WP_000753589.1.34838 WP_000753589.1.34855 WP_000753589.1.34875 WP_000753589.1.34887 WP_000753589.1.34913 WP_000753589.1.34931 WP_000753589.1.35003 WP_000753589.1.35006 WP_000753589.1.35007 WP_000753589.1.35132 WP_000753589.1.35168 WP_000753589.1.35198 WP_000753589.1.35211 WP_000753589.1.35253 WP_000753589.1.35316 WP_000753589.1.35365 WP_000753589.1.3539 WP_000753589.1.35393 WP_000753589.1.35448 WP_000753589.1.35464 WP_000753589.1.35465 WP_000753589.1.35468 WP_000753589.1.3550 WP_000753589.1.35627 WP_000753589.1.35653 WP_000753589.1.35922 WP_000753589.1.35927 WP_000753589.1.35934 WP_000753589.1.35963 WP_000753589.1.35987 WP_000753589.1.3600 WP_000753589.1.36010 WP_000753589.1.36042 WP_000753589.1.36070 WP_000753589.1.36071 WP_000753589.1.36094 WP_000753589.1.36105 WP_000753589.1.36132 WP_000753589.1.36158 WP_000753589.1.36166 WP_000753589.1.36177 WP_000753589.1.36212 WP_000753589.1.3624 WP_000753589.1.36405 WP_000753589.1.36412 WP_000753589.1.36414 WP_000753589.1.36426 WP_000753589.1.3643 WP_000753589.1.365 WP_000753589.1.36500 WP_000753589.1.36507 WP_000753589.1.36545 WP_000753589.1.36610 WP_000753589.1.36626 WP_000753589.1.36628 WP_000753589.1.36667 WP_000753589.1.3668 WP_000753589.1.36761 WP_000753589.1.36767 WP_000753589.1.36799 WP_000753589.1.36806 WP_000753589.1.36812 WP_000753589.1.36826 WP_000753589.1.36856 WP_000753589.1.36886 WP_000753589.1.36925 WP_000753589.1.3697 WP_000753589.1.36975 WP_000753589.1.37046 WP_000753589.1.37049 WP_000753589.1.37099 WP_000753589.1.37102 WP_000753589.1.37103 WP_000753589.1.37206 WP_000753589.1.37252 WP_000753589.1.37266 WP_000753589.1.37306 WP_000753589.1.37312 WP_000753589.1.37313 WP_000753589.1.37334 WP_000753589.1.37337 WP_000753589.1.37342 WP_000753589.1.37352 WP_000753589.1.37371 WP_000753589.1.37372 WP_000753589.1.37423 WP_000753589.1.37472 WP_000753589.1.37476 WP_000753589.1.37510 WP_000753589.1.37544 WP_000753589.1.37550 WP_000753589.1.37554 WP_000753589.1.37608 WP_000753589.1.3762 WP_000753589.1.37634 WP_000753589.1.377 WP_000753589.1.3772 WP_000753589.1.37731 WP_000753589.1.37736 WP_000753589.1.37766 WP_000753589.1.37769 WP_000753589.1.37847 WP_000753589.1.37852 WP_000753589.1.37853 WP_000753589.1.37880 WP_000753589.1.37917 WP_000753589.1.37923 WP_000753589.1.37926 WP_000753589.1.3795 WP_000753589.1.37962 WP_000753589.1.37995 WP_000753589.1.37998 WP_000753589.1.38000 WP_000753589.1.38033 WP_000753589.1.38043 WP_000753589.1.38050 WP_000753589.1.38063 WP_000753589.1.38081 WP_000753589.1.38103 WP_000753589.1.38107 WP_000753589.1.38120 WP_000753589.1.38194 WP_000753589.1.3822 WP_000753589.1.38257 WP_000753589.1.38293 WP_000753589.1.38300 WP_000753589.1.38306 WP_000753589.1.38314 WP_000753589.1.38357 WP_000753589.1.38369 WP_000753589.1.38392 WP_000753589.1.38412 WP_000753589.1.38561 WP_000753589.1.38567 WP_000753589.1.38626 WP_000753589.1.38629 WP_000753589.1.38694 WP_000753589.1.3873 WP_000753589.1.38782 WP_000753589.1.38835 WP_000753589.1.38896 WP_000753589.1.389 WP_000753589.1.38935 WP_000753589.1.38958 WP_000753589.1.39005 WP_000753589.1.39037 WP_000753589.1.3904 WP_000753589.1.39103 WP_000753589.1.39123 WP_000753589.1.39148 WP_000753589.1.39150 WP_000753589.1.39180 WP_000753589.1.3922 WP_000753589.1.39232 WP_000753589.1.39268 WP_000753589.1.39289 WP_000753589.1.39302 WP_000753589.1.39305 WP_000753589.1.39310 WP_000753589.1.39327 WP_000753589.1.39401 WP_000753589.1.39402 WP_000753589.1.39415 WP_000753589.1.39492 WP_000753589.1.39509 WP_000753589.1.3954 WP_000753589.1.39564 WP_000753589.1.39575 WP_000753589.1.39601 WP_000753589.1.39607 WP_000753589.1.39610 WP_000753589.1.39626 WP_000753589.1.39646 WP_000753589.1.39690 WP_000753589.1.3970 WP_000753589.1.39708 WP_000753589.1.39713 WP_000753589.1.39726 WP_000753589.1.39780 WP_000753589.1.39809 WP_000753589.1.39820 WP_000753589.1.39822 WP_000753589.1.39867 WP_000753589.1.39892 WP_000753589.1.39973 WP_000753589.1.4005 WP_000753589.1.40083 WP_000753589.1.40088 WP_000753589.1.40107 WP_000753589.1.40113 WP_000753589.1.40147 WP_000753589.1.40153 WP_000753589.1.4020 WP_000753589.1.40206 WP_000753589.1.40211 WP_000753589.1.40234 WP_000753589.1.40249 WP_000753589.1.4030 WP_000753589.1.40300 WP_000753589.1.40315 WP_000753589.1.40319 WP_000753589.1.40335 WP_000753589.1.40345 WP_000753589.1.40360 WP_000753589.1.40382 WP_000753589.1.40391 WP_000753589.1.40403 WP_000753589.1.4049 WP_000753589.1.40539 WP_000753589.1.40549 WP_000753589.1.40560 WP_000753589.1.40563 WP_000753589.1.40596 WP_000753589.1.40599 WP_000753589.1.40617 WP_000753589.1.40629 WP_000753589.1.40636 WP_000753589.1.40657 WP_000753589.1.40660 WP_000753589.1.40686 WP_000753589.1.40715 WP_000753589.1.40742 WP_000753589.1.40758 WP_000753589.1.40781 WP_000753589.1.40793 WP_000753589.1.4082 WP_000753589.1.40865 WP_000753589.1.40882 WP_000753589.1.40893 WP_000753589.1.40900 WP_000753589.1.40952 WP_000753589.1.4103 WP_000753589.1.41037 WP_000753589.1.41045 WP_000753589.1.41060 WP_000753589.1.41125 WP_000753589.1.41239 WP_000753589.1.41287 WP_000753589.1.41294 WP_000753589.1.41315 WP_000753589.1.41330 WP_000753589.1.41371 WP_000753589.1.41392 WP_000753589.1.41401 WP_000753589.1.41407 WP_000753589.1.4142 WP_000753589.1.41453 WP_000753589.1.41455 WP_000753589.1.41466 WP_000753589.1.41478 WP_000753589.1.41479 WP_000753589.1.41483 WP_000753589.1.41536 WP_000753589.1.41566 WP_000753589.1.4158 WP_000753589.1.41613 WP_000753589.1.41712 WP_000753589.1.4172 WP_000753589.1.41734 WP_000753589.1.41752 WP_000753589.1.41783 WP_000753589.1.41809 WP_000753589.1.41837 WP_000753589.1.41847 WP_000753589.1.41849 WP_000753589.1.41884 WP_000753589.1.4189 WP_000753589.1.41923 WP_000753589.1.4193 WP_000753589.1.41956 WP_000753589.1.41964 WP_000753589.1.41988 WP_000753589.1.41990 WP_000753589.1.41991 WP_000753589.1.42036 WP_000753589.1.42038 WP_000753589.1.42044 WP_000753589.1.42060 WP_000753589.1.4213 WP_000753589.1.42138 WP_000753589.1.42151 WP_000753589.1.42203 WP_000753589.1.42221 WP_000753589.1.42226 WP_000753589.1.42228 WP_000753589.1.4224 WP_000753589.1.42350 WP_000753589.1.42367 WP_000753589.1.42387 WP_000753589.1.42413 WP_000753589.1.42415 WP_000753589.1.42442 WP_000753589.1.42443 WP_000753589.1.42447 WP_000753589.1.42456 WP_000753589.1.42480 WP_000753589.1.4250 WP_000753589.1.42513 WP_000753589.1.42522 WP_000753589.1.42594 WP_000753589.1.42601 WP_000753589.1.4261 WP_000753589.1.42638 WP_000753589.1.42661 WP_000753589.1.42669 WP_000753589.1.42670 WP_000753589.1.42677 WP_000753589.1.42709 WP_000753589.1.42748 WP_000753589.1.42756 WP_000753589.1.42771 WP_000753589.1.42804 WP_000753589.1.42832 WP_000753589.1.42863 WP_000753589.1.42891 WP_000753589.1.42937 WP_000753589.1.42950 WP_000753589.1.42962 WP_000753589.1.42975 WP_000753589.1.42991 WP_000753589.1.43013 WP_000753589.1.43027 WP_000753589.1.43079 WP_000753589.1.43121 WP_000753589.1.43123 WP_000753589.1.4313 WP_000753589.1.43132 WP_000753589.1.43137 WP_000753589.1.43140 WP_000753589.1.43166 WP_000753589.1.43170 WP_000753589.1.43177 WP_000753589.1.43196 WP_000753589.1.43213 WP_000753589.1.43239 WP_000753589.1.43278 WP_000753589.1.43316 WP_000753589.1.4334 WP_000753589.1.43363 WP_000753589.1.43384 WP_000753589.1.4342 WP_000753589.1.43422 WP_000753589.1.4343 WP_000753589.1.43448 WP_000753589.1.43469 WP_000753589.1.43501 WP_000753589.1.43536 WP_000753589.1.436 WP_000753589.1.43604 WP_000753589.1.43642 WP_000753589.1.43733 WP_000753589.1.43738 WP_000753589.1.43754 WP_000753589.1.43769 WP_000753589.1.43798 WP_000753589.1.43803 WP_000753589.1.43816 WP_000753589.1.43837 WP_000753589.1.43858 WP_000753589.1.43911 WP_000753589.1.43939 WP_000753589.1.43942 WP_000753589.1.440 WP_000753589.1.44018 WP_000753589.1.44029 WP_000753589.1.44040 WP_000753589.1.44077 WP_000753589.1.44125 WP_000753589.1.44130 WP_000753589.1.4415 WP_000753589.1.44165 WP_000753589.1.44203 WP_000753589.1.44238 WP_000753589.1.44251 WP_000753589.1.44263 WP_000753589.1.44273 WP_000753589.1.44292 WP_000753589.1.44389 WP_000753589.1.44445 WP_000753589.1.44447 WP_000753589.1.44460 WP_000753589.1.44461 WP_000753589.1.44488 WP_000753589.1.4449 WP_000753589.1.4454 WP_000753589.1.44561 WP_000753589.1.44587 WP_000753589.1.44608 WP_000753589.1.44649 WP_000753589.1.44661 WP_000753589.1.44668 WP_000753589.1.4471 WP_000753589.1.4473 WP_000753589.1.44733 WP_000753589.1.44756 WP_000753589.1.44800 WP_000753589.1.44906 WP_000753589.1.44954 WP_000753589.1.44961 WP_000753589.1.44975 WP_000753589.1.45020 WP_000753589.1.45053 WP_000753589.1.45076 WP_000753589.1.45153 WP_000753589.1.45195 WP_000753589.1.45293 WP_000753589.1.45301 WP_000753589.1.45359 WP_000753589.1.4538 WP_000753589.1.45404 WP_000753589.1.45405 WP_000753589.1.4541 WP_000753589.1.45444 WP_000753589.1.45536 WP_000753589.1.45565 WP_000753589.1.45575 WP_000753589.1.45600 WP_000753589.1.45627 WP_000753589.1.45664 WP_000753589.1.45674 WP_000753589.1.45676 WP_000753589.1.45707 WP_000753589.1.45718 WP_000753589.1.45740 WP_000753589.1.4583 WP_000753589.1.45841 WP_000753589.1.45846 WP_000753589.1.45865 WP_000753589.1.45868 WP_000753589.1.45901 WP_000753589.1.45930 WP_000753589.1.45931 WP_000753589.1.45941 WP_000753589.1.45960 WP_000753589.1.45968 WP_000753589.1.45990 WP_000753589.1.4600 WP_000753589.1.46016 WP_000753589.1.46027 WP_000753589.1.46039 WP_000753589.1.46048 WP_000753589.1.46049 WP_000753589.1.46070 WP_000753589.1.46081 WP_000753589.1.46105 WP_000753589.1.4613 WP_000753589.1.4619 WP_000753589.1.46239 WP_000753589.1.46263 WP_000753589.1.46282 WP_000753589.1.46283 WP_000753589.1.46291 WP_000753589.1.46301 WP_000753589.1.46369 WP_000753589.1.46379 WP_000753589.1.46414 WP_000753589.1.46451 WP_000753589.1.4647 WP_000753589.1.46477 WP_000753589.1.46503 WP_000753589.1.46526 WP_000753589.1.46531 WP_000753589.1.46555 WP_000753589.1.46594 WP_000753589.1.46597 WP_000753589.1.46611 WP_000753589.1.46614 WP_000753589.1.46616 WP_000753589.1.46626 WP_000753589.1.46668 WP_000753589.1.46743 WP_000753589.1.46798 WP_000753589.1.46806 WP_000753589.1.46810 WP_000753589.1.46821 WP_000753589.1.46832 WP_000753589.1.46833 WP_000753589.1.46841 WP_000753589.1.46882 WP_000753589.1.46912 WP_000753589.1.46913 WP_000753589.1.4695 WP_000753589.1.46990 WP_000753589.1.46999 WP_000753589.1.47024 WP_000753589.1.47029 WP_000753589.1.47034 WP_000753589.1.47039 WP_000753589.1.47050 WP_000753589.1.47054 WP_000753589.1.47069 WP_000753589.1.47073 WP_000753589.1.4708 WP_000753589.1.47140 WP_000753589.1.47167 WP_000753589.1.4723 WP_000753589.1.47246 WP_000753589.1.47247 WP_000753589.1.4725 WP_000753589.1.47280 WP_000753589.1.47307 WP_000753589.1.47319 WP_000753589.1.47349 WP_000753589.1.47356 WP_000753589.1.47370 WP_000753589.1.47398 WP_000753589.1.4740 WP_000753589.1.47411 WP_000753589.1.47425 WP_000753589.1.47473 WP_000753589.1.47477 WP_000753589.1.47488 WP_000753589.1.47529 WP_000753589.1.47546 WP_000753589.1.47599 WP_000753589.1.47654 WP_000753589.1.47662 WP_000753589.1.47784 WP_000753589.1.47827 WP_000753589.1.4783 WP_000753589.1.47848 WP_000753589.1.47884 WP_000753589.1.47935 WP_000753589.1.47954 WP_000753589.1.4796 WP_000753589.1.47976 WP_000753589.1.47994 WP_000753589.1.48000 WP_000753589.1.48018 WP_000753589.1.48029 WP_000753589.1.48051 WP_000753589.1.48065 WP_000753589.1.48077 WP_000753589.1.48090 WP_000753589.1.4812 WP_000753589.1.48121 WP_000753589.1.48144 WP_000753589.1.48168 WP_000753589.1.48176 WP_000753589.1.48188 WP_000753589.1.48216 WP_000753589.1.48226 WP_000753589.1.48258 WP_000753589.1.4826 WP_000753589.1.48265 WP_000753589.1.48291 WP_000753589.1.48317 WP_000753589.1.48355 WP_000753589.1.48385 WP_000753589.1.48421 WP_000753589.1.48433 WP_000753589.1.48469 WP_000753589.1.4857 WP_000753589.1.48571 WP_000753589.1.48615 WP_000753589.1.48620 WP_000753589.1.48626 WP_000753589.1.48629 WP_000753589.1.48678 WP_000753589.1.48689 WP_000753589.1.48697 WP_000753589.1.48712 WP_000753589.1.4876 WP_000753589.1.48792 WP_000753589.1.48801 WP_000753589.1.48806 WP_000753589.1.48808 WP_000753589.1.48827 WP_000753589.1.48901 WP_000753589.1.48902 WP_000753589.1.4892 WP_000753589.1.48921 WP_000753589.1.48928 WP_000753589.1.48954 WP_000753589.1.49061 WP_000753589.1.49107 WP_000753589.1.49124 WP_000753589.1.49147 WP_000753589.1.49229 WP_000753589.1.4931 WP_000753589.1.49312 WP_000753589.1.49321 WP_000753589.1.49332 WP_000753589.1.49336 WP_000753589.1.49342 WP_000753589.1.49347 WP_000753589.1.49401 WP_000753589.1.49459 WP_000753589.1.49464 WP_000753589.1.49481 WP_000753589.1.4949 WP_000753589.1.49496 WP_000753589.1.49521 WP_000753589.1.49522 WP_000753589.1.49546 WP_000753589.1.49558 WP_000753589.1.49567 WP_000753589.1.49594 WP_000753589.1.49599 WP_000753589.1.49615 WP_000753589.1.49625 WP_000753589.1.49655 WP_000753589.1.49662 WP_000753589.1.49675 WP_000753589.1.49712 WP_000753589.1.49722 WP_000753589.1.49771 WP_000753589.1.49774 WP_000753589.1.49783 WP_000753589.1.49788 WP_000753589.1.49794 WP_000753589.1.4985 WP_000753589.1.49856 WP_000753589.1.49861 WP_000753589.1.49879 WP_000753589.1.49884 WP_000753589.1.49941 WP_000753589.1.49950 WP_000753589.1.49954 WP_000753589.1.49972 WP_000753589.1.49987 WP_000753589.1.5003 WP_000753589.1.50036 WP_000753589.1.50058 WP_000753589.1.50110 WP_000753589.1.50113 WP_000753589.1.50119 WP_000753589.1.50146 WP_000753589.1.50182 WP_000753589.1.50207 WP_000753589.1.50214 WP_000753589.1.50258 WP_000753589.1.50269 WP_000753589.1.50345 WP_000753589.1.50353 WP_000753589.1.50358 WP_000753589.1.5037 WP_000753589.1.50380 WP_000753589.1.50418 WP_000753589.1.50549 WP_000753589.1.50585 WP_000753589.1.50586 WP_000753589.1.50608 WP_000753589.1.50616 WP_000753589.1.5064 WP_000753589.1.50690 WP_000753589.1.50700 WP_000753589.1.50715 WP_000753589.1.50725 WP_000753589.1.50728 WP_000753589.1.50762 WP_000753589.1.50887 WP_000753589.1.50939 WP_000753589.1.50986 WP_000753589.1.50988 WP_000753589.1.50990 WP_000753589.1.51027 WP_000753589.1.51058 WP_000753589.1.51109 WP_000753589.1.51154 WP_000753589.1.51170 WP_000753589.1.51171 WP_000753589.1.51175 WP_000753589.1.51180 WP_000753589.1.51190 WP_000753589.1.51211 WP_000753589.1.5124 WP_000753589.1.51248 WP_000753589.1.51253 WP_000753589.1.51260 WP_000753589.1.51278 WP_000753589.1.51299 WP_000753589.1.51323 WP_000753589.1.51360 WP_000753589.1.51392 WP_000753589.1.51405 WP_000753589.1.51427 WP_000753589.1.51462 WP_000753589.1.51490 WP_000753589.1.51505 WP_000753589.1.51525 WP_000753589.1.51537 WP_000753589.1.51580 WP_000753589.1.51596 WP_000753589.1.51629 WP_000753589.1.51643 WP_000753589.1.51693 WP_000753589.1.51718 WP_000753589.1.5172 WP_000753589.1.51760 WP_000753589.1.518 WP_000753589.1.51834 WP_000753589.1.51837 WP_000753589.1.51839 WP_000753589.1.51896 WP_000753589.1.51899 WP_000753589.1.51944 WP_000753589.1.51949 WP_000753589.1.51979 WP_000753589.1.51985 WP_000753589.1.51988 WP_000753589.1.5199 WP_000753589.1.52039 WP_000753589.1.52048 WP_000753589.1.52098 WP_000753589.1.5217 WP_000753589.1.52171 WP_000753589.1.52213 WP_000753589.1.52257 WP_000753589.1.5227 WP_000753589.1.52272 WP_000753589.1.52313 WP_000753589.1.52333 WP_000753589.1.52363 WP_000753589.1.5239 WP_000753589.1.52419 WP_000753589.1.52496 WP_000753589.1.52543 WP_000753589.1.52631 WP_000753589.1.52662 WP_000753589.1.52691 WP_000753589.1.52710 WP_000753589.1.52735 WP_000753589.1.52762 WP_000753589.1.52777 WP_000753589.1.52781 WP_000753589.1.52801 WP_000753589.1.52846 WP_000753589.1.52855 WP_000753589.1.52881 WP_000753589.1.52883 WP_000753589.1.52913 WP_000753589.1.52933 WP_000753589.1.52962 WP_000753589.1.52995 WP_000753589.1.53027 WP_000753589.1.53065 WP_000753589.1.53084 WP_000753589.1.5310 WP_000753589.1.53123 WP_000753589.1.53155 WP_000753589.1.53181 WP_000753589.1.532 WP_000753589.1.53211 WP_000753589.1.5322 WP_000753589.1.53223 WP_000753589.1.53238 WP_000753589.1.53242 WP_000753589.1.53251 WP_000753589.1.53252 WP_000753589.1.53262 WP_000753589.1.53270 WP_000753589.1.53356 WP_000753589.1.53360 WP_000753589.1.53401 WP_000753589.1.53410 WP_000753589.1.5342 WP_000753589.1.53537 WP_000753589.1.53556 WP_000753589.1.53557 WP_000753589.1.53587 WP_000753589.1.53589 WP_000753589.1.5362 WP_000753589.1.53642 WP_000753589.1.53687 WP_000753589.1.53809 WP_000753589.1.53810 WP_000753589.1.53841 WP_000753589.1.53866 WP_000753589.1.53884 WP_000753589.1.5391 WP_000753589.1.5393 WP_000753589.1.53978 WP_000753589.1.53991 WP_000753589.1.54023 WP_000753589.1.54024 WP_000753589.1.54051 WP_000753589.1.54072 WP_000753589.1.54091 WP_000753589.1.54095 WP_000753589.1.54102 WP_000753589.1.54169 WP_000753589.1.54185 WP_000753589.1.54202 WP_000753589.1.54213 WP_000753589.1.54307 WP_000753589.1.54313 WP_000753589.1.54317 WP_000753589.1.54388 WP_000753589.1.54394 WP_000753589.1.5441 WP_000753589.1.54411 WP_000753589.1.54417 WP_000753589.1.54418 WP_000753589.1.54439 WP_000753589.1.54454 WP_000753589.1.5460 WP_000753589.1.54601 WP_000753589.1.54638 WP_000753589.1.54643 WP_000753589.1.5467 WP_000753589.1.54688 WP_000753589.1.54708 WP_000753589.1.54725 WP_000753589.1.54729 WP_000753589.1.54760 WP_000753589.1.5479 WP_000753589.1.54798 WP_000753589.1.54817 WP_000753589.1.54829 WP_000753589.1.5486 WP_000753589.1.54875 WP_000753589.1.54883 WP_000753589.1.54918 WP_000753589.1.54991 WP_000753589.1.55115 WP_000753589.1.55134 WP_000753589.1.55144 WP_000753589.1.55149 WP_000753589.1.55179 WP_000753589.1.55197 WP_000753589.1.5520 WP_000753589.1.55218 WP_000753589.1.55222 WP_000753589.1.55273 WP_000753589.1.55275 WP_000753589.1.55286 WP_000753589.1.55291 WP_000753589.1.55338 WP_000753589.1.55381 WP_000753589.1.55417 WP_000753589.1.55492 WP_000753589.1.55550 WP_000753589.1.55552 WP_000753589.1.55608 WP_000753589.1.5561 WP_000753589.1.55787 WP_000753589.1.55791 WP_000753589.1.55820 WP_000753589.1.55838 WP_000753589.1.55844 WP_000753589.1.55892 WP_000753589.1.55897 WP_000753589.1.55936 WP_000753589.1.55981 WP_000753589.1.55988 WP_000753589.1.56033 WP_000753589.1.56040 WP_000753589.1.56047 WP_000753589.1.56072 WP_000753589.1.56139 WP_000753589.1.56142 WP_000753589.1.56149 WP_000753589.1.56151 WP_000753589.1.5616 WP_000753589.1.56177 WP_000753589.1.56193 WP_000753589.1.56216 WP_000753589.1.56231 WP_000753589.1.56278 WP_000753589.1.56293 WP_000753589.1.56302 WP_000753589.1.5632 WP_000753589.1.56338 WP_000753589.1.5639 WP_000753589.1.56392 WP_000753589.1.56399 WP_000753589.1.56402 WP_000753589.1.56439 WP_000753589.1.56457 WP_000753589.1.5646 WP_000753589.1.56481 WP_000753589.1.56489 WP_000753589.1.56491 WP_000753589.1.56501 WP_000753589.1.56513 WP_000753589.1.56523 WP_000753589.1.56543 WP_000753589.1.56554 WP_000753589.1.56571 WP_000753589.1.56586 WP_000753589.1.56650 WP_000753589.1.56680 WP_000753589.1.56689 WP_000753589.1.5670 WP_000753589.1.56721 WP_000753589.1.56742 WP_000753589.1.56799 WP_000753589.1.56821 WP_000753589.1.56835 WP_000753589.1.5685 WP_000753589.1.56933 WP_000753589.1.56936 WP_000753589.1.57011 WP_000753589.1.57032 WP_000753589.1.57045 WP_000753589.1.57068 WP_000753589.1.57071 WP_000753589.1.57100 WP_000753589.1.57180 WP_000753589.1.57182 WP_000753589.1.57197 WP_000753589.1.57202 WP_000753589.1.57216 WP_000753589.1.57222 WP_000753589.1.57280 WP_000753589.1.57281 WP_000753589.1.57451 WP_000753589.1.57453 WP_000753589.1.57466 WP_000753589.1.5748 WP_000753589.1.57487 WP_000753589.1.57538 WP_000753589.1.57550 WP_000753589.1.57610 WP_000753589.1.57629 WP_000753589.1.5764 WP_000753589.1.57646 WP_000753589.1.57738 WP_000753589.1.57812 WP_000753589.1.57836 WP_000753589.1.57854 WP_000753589.1.57920 WP_000753589.1.57982 WP_000753589.1.57983 WP_000753589.1.57994 WP_000753589.1.58009 WP_000753589.1.58022 WP_000753589.1.58038 WP_000753589.1.58045 WP_000753589.1.58048 WP_000753589.1.58057 WP_000753589.1.58094 WP_000753589.1.58098 WP_000753589.1.58107 WP_000753589.1.58128 WP_000753589.1.58146 WP_000753589.1.58169 WP_000753589.1.58172 WP_000753589.1.58238 WP_000753589.1.58248 WP_000753589.1.58267 WP_000753589.1.58289 WP_000753589.1.58336 WP_000753589.1.584 WP_000753589.1.58408 WP_000753589.1.58414 WP_000753589.1.58423 WP_000753589.1.58424 WP_000753589.1.58459 WP_000753589.1.58493 WP_000753589.1.58507 WP_000753589.1.5852 WP_000753589.1.58528 WP_000753589.1.58552 WP_000753589.1.58560 WP_000753589.1.58572 WP_000753589.1.58609 WP_000753589.1.58622 WP_000753589.1.58657 WP_000753589.1.58705 WP_000753589.1.58707 WP_000753589.1.58723 WP_000753589.1.58799 WP_000753589.1.58901 WP_000753589.1.58977 WP_000753589.1.58983 WP_000753589.1.58999 WP_000753589.1.59038 WP_000753589.1.59055 WP_000753589.1.5906 WP_000753589.1.59073 WP_000753589.1.59190 WP_000753589.1.59199 WP_000753589.1.59263 WP_000753589.1.5927 WP_000753589.1.59280 WP_000753589.1.59291 WP_000753589.1.59359 WP_000753589.1.59374 WP_000753589.1.59409 WP_000753589.1.59413 WP_000753589.1.5942 WP_000753589.1.59426 WP_000753589.1.59434 WP_000753589.1.59470 WP_000753589.1.59491 WP_000753589.1.59572 WP_000753589.1.59577 WP_000753589.1.59579 WP_000753589.1.59613 WP_000753589.1.59621 WP_000753589.1.5963 WP_000753589.1.59660 WP_000753589.1.59679 WP_000753589.1.59699 WP_000753589.1.59714 WP_000753589.1.59733 WP_000753589.1.59737 WP_000753589.1.59745 WP_000753589.1.59748 WP_000753589.1.59782 WP_000753589.1.59838 WP_000753589.1.59853 WP_000753589.1.59894 WP_000753589.1.59905 WP_000753589.1.59931 WP_000753589.1.59932 WP_000753589.1.59959 WP_000753589.1.59981 WP_000753589.1.60023 WP_000753589.1.60042 WP_000753589.1.60043 WP_000753589.1.60070 WP_000753589.1.60110 WP_000753589.1.60117 WP_000753589.1.6013 WP_000753589.1.60133 WP_000753589.1.6022 WP_000753589.1.60225 WP_000753589.1.60235 WP_000753589.1.60304 WP_000753589.1.60325 WP_000753589.1.60337 WP_000753589.1.60343 WP_000753589.1.60350 WP_000753589.1.60373 WP_000753589.1.60374 WP_000753589.1.60387 WP_000753589.1.60436 WP_000753589.1.60457 WP_000753589.1.60461 WP_000753589.1.6059 WP_000753589.1.60591 WP_000753589.1.60606 WP_000753589.1.60613 WP_000753589.1.60630 WP_000753589.1.6064 WP_000753589.1.60647 WP_000753589.1.6068 WP_000753589.1.60698 WP_000753589.1.60732 WP_000753589.1.60744 WP_000753589.1.60761 WP_000753589.1.60832 WP_000753589.1.60835 WP_000753589.1.60872 WP_000753589.1.60935 WP_000753589.1.61006 WP_000753589.1.61035 WP_000753589.1.61039 WP_000753589.1.61099 WP_000753589.1.6110 WP_000753589.1.61108 WP_000753589.1.61112 WP_000753589.1.61121 WP_000753589.1.61132 WP_000753589.1.61174 WP_000753589.1.61175 WP_000753589.1.61186 WP_000753589.1.61225 WP_000753589.1.61245 WP_000753589.1.61253 WP_000753589.1.61284 WP_000753589.1.613 WP_000753589.1.61360 WP_000753589.1.61364 WP_000753589.1.6138 WP_000753589.1.61398 WP_000753589.1.61442 WP_000753589.1.61445 WP_000753589.1.61480 WP_000753589.1.61623 WP_000753589.1.61739 WP_000753589.1.61758 WP_000753589.1.61772 WP_000753589.1.618 WP_000753589.1.61806 WP_000753589.1.61835 WP_000753589.1.61874 WP_000753589.1.61926 WP_000753589.1.61948 WP_000753589.1.61957 WP_000753589.1.61985 WP_000753589.1.62038 WP_000753589.1.62102 WP_000753589.1.62135 WP_000753589.1.62157 WP_000753589.1.62182 WP_000753589.1.62236 WP_000753589.1.62264 WP_000753589.1.62290 WP_000753589.1.62337 WP_000753589.1.62358 WP_000753589.1.62424 WP_000753589.1.62454 WP_000753589.1.62460 WP_000753589.1.62480 WP_000753589.1.62487 WP_000753589.1.62503 WP_000753589.1.62514 WP_000753589.1.62529 WP_000753589.1.62555 WP_000753589.1.6261 WP_000753589.1.62631 WP_000753589.1.62646 WP_000753589.1.62675 WP_000753589.1.62681 WP_000753589.1.62714 WP_000753589.1.62762 WP_000753589.1.62769 WP_000753589.1.62780 WP_000753589.1.62788 WP_000753589.1.62818 WP_000753589.1.62819 WP_000753589.1.6282 WP_000753589.1.62843 WP_000753589.1.62850 WP_000753589.1.62851 WP_000753589.1.62866 WP_000753589.1.62885 WP_000753589.1.62888 WP_000753589.1.62914 WP_000753589.1.62951 WP_000753589.1.62973 WP_000753589.1.6299 WP_000753589.1.6307 WP_000753589.1.63078 WP_000753589.1.63177 WP_000753589.1.6331 WP_000753589.1.63374 WP_000753589.1.63437 WP_000753589.1.63445 WP_000753589.1.63467 WP_000753589.1.63470 WP_000753589.1.63484 WP_000753589.1.63491 WP_000753589.1.63496 WP_000753589.1.63536 WP_000753589.1.63556 WP_000753589.1.63563 WP_000753589.1.63576 WP_000753589.1.63586 WP_000753589.1.63604 WP_000753589.1.63608 WP_000753589.1.63615 WP_000753589.1.6364 WP_000753589.1.63666 WP_000753589.1.63679 WP_000753589.1.63810 WP_000753589.1.63814 WP_000753589.1.63872 WP_000753589.1.63957 WP_000753589.1.63969 WP_000753589.1.64008 WP_000753589.1.64014 WP_000753589.1.64050 WP_000753589.1.64053 WP_000753589.1.64074 WP_000753589.1.64086 WP_000753589.1.64150 WP_000753589.1.64161 WP_000753589.1.64193 WP_000753589.1.64286 WP_000753589.1.64312 WP_000753589.1.64355 WP_000753589.1.64356 WP_000753589.1.64371 WP_000753589.1.64380 WP_000753589.1.64391 WP_000753589.1.64417 WP_000753589.1.64438 WP_000753589.1.6445 WP_000753589.1.64458 WP_000753589.1.64519 WP_000753589.1.64520 WP_000753589.1.64528 WP_000753589.1.64547 WP_000753589.1.64621 WP_000753589.1.64657 WP_000753589.1.64670 WP_000753589.1.64707 WP_000753589.1.64840 WP_000753589.1.64875 WP_000753589.1.64881 WP_000753589.1.64901 WP_000753589.1.64946 WP_000753589.1.64970 WP_000753589.1.64990 WP_000753589.1.65023 WP_000753589.1.65035 WP_000753589.1.65084 WP_000753589.1.65097 WP_000753589.1.6511 WP_000753589.1.65114 WP_000753589.1.65118 WP_000753589.1.65122 WP_000753589.1.65155 WP_000753589.1.65194 WP_000753589.1.65240 WP_000753589.1.65286 WP_000753589.1.65305 WP_000753589.1.65306 WP_000753589.1.65355 WP_000753589.1.65372 WP_000753589.1.654 WP_000753589.1.65405 WP_000753589.1.65493 WP_000753589.1.65531 WP_000753589.1.65546 WP_000753589.1.65581 WP_000753589.1.65606 WP_000753589.1.65708 WP_000753589.1.65762 WP_000753589.1.6587 WP_000753589.1.65875 WP_000753589.1.65962 WP_000753589.1.65963 WP_000753589.1.65976 WP_000753589.1.65978 WP_000753589.1.65988 WP_000753589.1.6599 WP_000753589.1.65991 WP_000753589.1.66001 WP_000753589.1.66007 WP_000753589.1.66016 WP_000753589.1.66017 WP_000753589.1.66033 WP_000753589.1.6604 WP_000753589.1.66044 WP_000753589.1.66071 WP_000753589.1.6609 WP_000753589.1.66094 WP_000753589.1.66100 WP_000753589.1.66121 WP_000753589.1.66161 WP_000753589.1.6618 WP_000753589.1.66181 WP_000753589.1.66255 WP_000753589.1.66288 WP_000753589.1.66290 WP_000753589.1.66376 WP_000753589.1.66392 WP_000753589.1.66412 WP_000753589.1.66448 WP_000753589.1.6645 WP_000753589.1.66523 WP_000753589.1.66531 WP_000753589.1.66566 WP_000753589.1.66579 WP_000753589.1.66668 WP_000753589.1.66708 WP_000753589.1.66758 WP_000753589.1.6676 WP_000753589.1.66794 WP_000753589.1.66873 WP_000753589.1.66922 WP_000753589.1.66926 WP_000753589.1.66948 WP_000753589.1.6698 WP_000753589.1.66984 WP_000753589.1.67018 WP_000753589.1.67026 WP_000753589.1.67035 WP_000753589.1.67055 WP_000753589.1.6706 WP_000753589.1.67073 WP_000753589.1.67102 WP_000753589.1.67116 WP_000753589.1.67120 WP_000753589.1.67136 WP_000753589.1.67150 WP_000753589.1.67153 WP_000753589.1.67174 WP_000753589.1.67194 WP_000753589.1.67209 WP_000753589.1.67214 WP_000753589.1.67258 WP_000753589.1.67284 WP_000753589.1.6735 WP_000753589.1.67373 WP_000753589.1.67383 WP_000753589.1.67427 WP_000753589.1.67446 WP_000753589.1.67452 WP_000753589.1.67464 WP_000753589.1.67495 WP_000753589.1.67533 WP_000753589.1.67581 WP_000753589.1.67606 WP_000753589.1.67676 WP_000753589.1.6769 WP_000753589.1.67701 WP_000753589.1.67724 WP_000753589.1.67726 WP_000753589.1.67737 WP_000753589.1.67753 WP_000753589.1.67760 WP_000753589.1.67775 WP_000753589.1.67780 WP_000753589.1.678 WP_000753589.1.67841 WP_000753589.1.67894 WP_000753589.1.6793 WP_000753589.1.67999 WP_000753589.1.68011 WP_000753589.1.68058 WP_000753589.1.68063 WP_000753589.1.68070 WP_000753589.1.68096 WP_000753589.1.68138 WP_000753589.1.68177 WP_000753589.1.682 WP_000753589.1.68200 WP_000753589.1.68231 WP_000753589.1.68241 WP_000753589.1.68255 WP_000753589.1.68278 WP_000753589.1.68300 WP_000753589.1.68347 WP_000753589.1.68362 WP_000753589.1.68411 WP_000753589.1.68493 WP_000753589.1.68523 WP_000753589.1.68524 WP_000753589.1.68572 WP_000753589.1.6859 WP_000753589.1.6860 WP_000753589.1.68609 WP_000753589.1.68632 WP_000753589.1.68673 WP_000753589.1.68678 WP_000753589.1.68695 WP_000753589.1.68735 WP_000753589.1.68750 WP_000753589.1.68795 WP_000753589.1.6880 WP_000753589.1.68801 WP_000753589.1.68847 WP_000753589.1.6887 WP_000753589.1.68873 WP_000753589.1.68877 WP_000753589.1.68911 WP_000753589.1.68924 WP_000753589.1.68936 WP_000753589.1.68942 WP_000753589.1.68956 WP_000753589.1.68989 WP_000753589.1.68995 WP_000753589.1.69054 WP_000753589.1.69098 WP_000753589.1.69126 WP_000753589.1.6921 WP_000753589.1.69221 WP_000753589.1.69327 WP_000753589.1.69350 WP_000753589.1.69351 WP_000753589.1.69390 WP_000753589.1.694 WP_000753589.1.69438 WP_000753589.1.69502 WP_000753589.1.69551 WP_000753589.1.69605 WP_000753589.1.69643 WP_000753589.1.69649 WP_000753589.1.69689 WP_000753589.1.69716 WP_000753589.1.69780 WP_000753589.1.69786 WP_000753589.1.69810 WP_000753589.1.69818 WP_000753589.1.69896 WP_000753589.1.7001 WP_000753589.1.70041 WP_000753589.1.70123 WP_000753589.1.70125 WP_000753589.1.7013 WP_000753589.1.70213 WP_000753589.1.70300 WP_000753589.1.70386 WP_000753589.1.70408 WP_000753589.1.70414 WP_000753589.1.70477 WP_000753589.1.7050 WP_000753589.1.70517 WP_000753589.1.7052 WP_000753589.1.70539 WP_000753589.1.70563 WP_000753589.1.70576 WP_000753589.1.70582 WP_000753589.1.70592 WP_000753589.1.70597 WP_000753589.1.70628 WP_000753589.1.70655 WP_000753589.1.70694 WP_000753589.1.70713 WP_000753589.1.70723 WP_000753589.1.70745 WP_000753589.1.70748 WP_000753589.1.70787 WP_000753589.1.70801 WP_000753589.1.70952 WP_000753589.1.70967 WP_000753589.1.71003 WP_000753589.1.71042 WP_000753589.1.71099 WP_000753589.1.71109 WP_000753589.1.71113 WP_000753589.1.71134 WP_000753589.1.71139 WP_000753589.1.71147 WP_000753589.1.71162 WP_000753589.1.71205 WP_000753589.1.71225 WP_000753589.1.71226 WP_000753589.1.71269 WP_000753589.1.71275 WP_000753589.1.71294 WP_000753589.1.71311 WP_000753589.1.71354 WP_000753589.1.71421 WP_000753589.1.71423 WP_000753589.1.71448 WP_000753589.1.71533 WP_000753589.1.71537 WP_000753589.1.71540 WP_000753589.1.71562 WP_000753589.1.71563 WP_000753589.1.71607 WP_000753589.1.71680 WP_000753589.1.71712 WP_000753589.1.71732 WP_000753589.1.71840 WP_000753589.1.71855 WP_000753589.1.71856 WP_000753589.1.71874 WP_000753589.1.7192 WP_000753589.1.71939 WP_000753589.1.71940 WP_000753589.1.71972 WP_000753589.1.71987 WP_000753589.1.72013 WP_000753589.1.72016 WP_000753589.1.72021 WP_000753589.1.72028 WP_000753589.1.72048 WP_000753589.1.72053 WP_000753589.1.72066 WP_000753589.1.72090 WP_000753589.1.72125 WP_000753589.1.72141 WP_000753589.1.72153 WP_000753589.1.72161 WP_000753589.1.72180 WP_000753589.1.72208 WP_000753589.1.72212 WP_000753589.1.72240 WP_000753589.1.72248 WP_000753589.1.72270 WP_000753589.1.72322 WP_000753589.1.72359 WP_000753589.1.72388 WP_000753589.1.72427 WP_000753589.1.72436 WP_000753589.1.72493 WP_000753589.1.72535 WP_000753589.1.72551 WP_000753589.1.72588 WP_000753589.1.72596 WP_000753589.1.72614 WP_000753589.1.72641 WP_000753589.1.72643 WP_000753589.1.72694 WP_000753589.1.72695 WP_000753589.1.72700 WP_000753589.1.72706 WP_000753589.1.72725 WP_000753589.1.72729 WP_000753589.1.72751 WP_000753589.1.72758 WP_000753589.1.7277 WP_000753589.1.7281 WP_000753589.1.72837 WP_000753589.1.72858 WP_000753589.1.72893 WP_000753589.1.7291 WP_000753589.1.72913 WP_000753589.1.73000 WP_000753589.1.73010 WP_000753589.1.73032 WP_000753589.1.73061 WP_000753589.1.73072 WP_000753589.1.73075 WP_000753589.1.7309 WP_000753589.1.73126 WP_000753589.1.73215 WP_000753589.1.73239 WP_000753589.1.73249 WP_000753589.1.73257 WP_000753589.1.73259 WP_000753589.1.73277 WP_000753589.1.73283 WP_000753589.1.73291 WP_000753589.1.73326 WP_000753589.1.73343 WP_000753589.1.73344 WP_000753589.1.73349 WP_000753589.1.73428 WP_000753589.1.7345 WP_000753589.1.73468 WP_000753589.1.73486 WP_000753589.1.73626 WP_000753589.1.73663 WP_000753589.1.73709 WP_000753589.1.73743 WP_000753589.1.73785 WP_000753589.1.73797 WP_000753589.1.73801 WP_000753589.1.73807 WP_000753589.1.73882 WP_000753589.1.73908 WP_000753589.1.7392 WP_000753589.1.73934 WP_000753589.1.73968 WP_000753589.1.74045 WP_000753589.1.7407 WP_000753589.1.7425 WP_000753589.1.74251 WP_000753589.1.74267 WP_000753589.1.7429 WP_000753589.1.74367 WP_000753589.1.744 WP_000753589.1.74423 WP_000753589.1.74426 WP_000753589.1.74431 WP_000753589.1.7446 WP_000753589.1.74478 WP_000753589.1.74491 WP_000753589.1.74501 WP_000753589.1.74513 WP_000753589.1.74521 WP_000753589.1.74536 WP_000753589.1.74557 WP_000753589.1.74611 WP_000753589.1.74623 WP_000753589.1.74624 WP_000753589.1.74652 WP_000753589.1.74670 WP_000753589.1.74682 WP_000753589.1.74687 WP_000753589.1.74689 WP_000753589.1.74705 WP_000753589.1.74720 WP_000753589.1.74735 WP_000753589.1.74752 WP_000753589.1.74765 WP_000753589.1.74767 WP_000753589.1.7478 WP_000753589.1.74811 WP_000753589.1.74828 WP_000753589.1.74844 WP_000753589.1.74880 WP_000753589.1.74885 WP_000753589.1.74889 WP_000753589.1.74904 WP_000753589.1.75021 WP_000753589.1.75030 WP_000753589.1.75112 WP_000753589.1.75164 WP_000753589.1.75218 WP_000753589.1.75248 WP_000753589.1.75254 WP_000753589.1.75306 WP_000753589.1.7536 WP_000753589.1.75382 WP_000753589.1.7539 WP_000753589.1.75419 WP_000753589.1.75465 WP_000753589.1.75507 WP_000753589.1.75529 WP_000753589.1.75536 WP_000753589.1.75577 WP_000753589.1.75588 WP_000753589.1.75629 WP_000753589.1.75676 WP_000753589.1.75694 WP_000753589.1.75696 WP_000753589.1.75725 WP_000753589.1.75767 WP_000753589.1.75786 WP_000753589.1.7583 WP_000753589.1.75918 WP_000753589.1.75922 WP_000753589.1.75973 WP_000753589.1.75989 WP_000753589.1.76005 WP_000753589.1.76009 WP_000753589.1.76019 WP_000753589.1.7603 WP_000753589.1.76030 WP_000753589.1.76036 WP_000753589.1.76054 WP_000753589.1.76057 WP_000753589.1.7608 WP_000753589.1.76087 WP_000753589.1.76103 WP_000753589.1.76119 WP_000753589.1.7613 WP_000753589.1.76152 WP_000753589.1.76189 WP_000753589.1.76194 WP_000753589.1.76237 WP_000753589.1.76325 WP_000753589.1.76335 WP_000753589.1.76390 WP_000753589.1.76407 WP_000753589.1.76448 WP_000753589.1.76477 WP_000753589.1.76542 WP_000753589.1.76619 WP_000753589.1.76656 WP_000753589.1.76697 WP_000753589.1.76751 WP_000753589.1.76827 WP_000753589.1.76831 WP_000753589.1.76840 WP_000753589.1.76863 WP_000753589.1.76965 WP_000753589.1.76966 WP_000753589.1.7699 WP_000753589.1.76994 WP_000753589.1.77007 WP_000753589.1.77015 WP_000753589.1.77022 WP_000753589.1.77081 WP_000753589.1.77099 WP_000753589.1.771 WP_000753589.1.77109 WP_000753589.1.77128 WP_000753589.1.77134 WP_000753589.1.77147 WP_000753589.1.77162 WP_000753589.1.77163 WP_000753589.1.77173 WP_000753589.1.77200 WP_000753589.1.77204 WP_000753589.1.77224 WP_000753589.1.77239 WP_000753589.1.77275 WP_000753589.1.7729 WP_000753589.1.77290 WP_000753589.1.77296 WP_000753589.1.7731 WP_000753589.1.77392 WP_000753589.1.77432 WP_000753589.1.77437 WP_000753589.1.77462 WP_000753589.1.7747 WP_000753589.1.77477 WP_000753589.1.77481 WP_000753589.1.77495 WP_000753589.1.7750 WP_000753589.1.77511 WP_000753589.1.77551 WP_000753589.1.7756 WP_000753589.1.77577 WP_000753589.1.77581 WP_000753589.1.77608 WP_000753589.1.77626 WP_000753589.1.77632 WP_000753589.1.77644 WP_000753589.1.77707 WP_000753589.1.7775 WP_000753589.1.77760 WP_000753589.1.7780 WP_000753589.1.7781 WP_000753589.1.77826 WP_000753589.1.77833 WP_000753589.1.77929 WP_000753589.1.77949 WP_000753589.1.77961 WP_000753589.1.77979 WP_000753589.1.7799 WP_000753589.1.77999 WP_000753589.1.78010 WP_000753589.1.7808 WP_000753589.1.78102 WP_000753589.1.78183 WP_000753589.1.78187 WP_000753589.1.78202 WP_000753589.1.78297 WP_000753589.1.78305 WP_000753589.1.78376 WP_000753589.1.784 WP_000753589.1.78445 WP_000753589.1.78463 WP_000753589.1.78477 WP_000753589.1.78491 WP_000753589.1.78515 WP_000753589.1.7855 WP_000753589.1.78575 WP_000753589.1.78581 WP_000753589.1.78586 WP_000753589.1.78593 WP_000753589.1.78610 WP_000753589.1.78611 WP_000753589.1.78622 WP_000753589.1.78687 WP_000753589.1.78698 WP_000753589.1.78757 WP_000753589.1.78775 WP_000753589.1.78814 WP_000753589.1.7883 WP_000753589.1.78843 WP_000753589.1.78845 WP_000753589.1.78854 WP_000753589.1.78888 WP_000753589.1.78891 WP_000753589.1.78895 WP_000753589.1.78919 WP_000753589.1.78966 WP_000753589.1.7898 WP_000753589.1.78996 WP_000753589.1.79067 WP_000753589.1.79075 WP_000753589.1.79126 WP_000753589.1.79159 WP_000753589.1.79172 WP_000753589.1.79233 WP_000753589.1.79243 WP_000753589.1.79248 WP_000753589.1.79249 WP_000753589.1.79276 WP_000753589.1.79342 WP_000753589.1.79346 WP_000753589.1.79368 WP_000753589.1.79389 WP_000753589.1.79391 WP_000753589.1.7940 WP_000753589.1.7952 WP_000753589.1.79525 WP_000753589.1.79526 WP_000753589.1.79528 WP_000753589.1.79563 WP_000753589.1.79576 WP_000753589.1.79591 WP_000753589.1.79606 WP_000753589.1.79619 WP_000753589.1.79640 WP_000753589.1.79713 WP_000753589.1.79715 WP_000753589.1.79759 WP_000753589.1.79824 WP_000753589.1.79905 WP_000753589.1.79930 WP_000753589.1.79933 WP_000753589.1.79936 WP_000753589.1.79952 WP_000753589.1.79955 WP_000753589.1.79965 WP_000753589.1.79973 WP_000753589.1.79995 WP_000753589.1.80 WP_000753589.1.80016 WP_000753589.1.80026 WP_000753589.1.8004 WP_000753589.1.80043 WP_000753589.1.80096 WP_000753589.1.80106 WP_000753589.1.80112 WP_000753589.1.80141 WP_000753589.1.80168 WP_000753589.1.80176 WP_000753589.1.80309 WP_000753589.1.80310 WP_000753589.1.80330 WP_000753589.1.80392 WP_000753589.1.804 WP_000753589.1.80426 WP_000753589.1.80484 WP_000753589.1.80519 WP_000753589.1.80558 WP_000753589.1.80578 WP_000753589.1.80606 WP_000753589.1.8068 WP_000753589.1.80718 WP_000753589.1.80754 WP_000753589.1.8076 WP_000753589.1.80789 WP_000753589.1.80862 WP_000753589.1.80894 WP_000753589.1.80945 WP_000753589.1.80946 WP_000753589.1.80983 WP_000753589.1.80985 WP_000753589.1.810 WP_000753589.1.81026 WP_000753589.1.81032 WP_000753589.1.81036 WP_000753589.1.81056 WP_000753589.1.81070 WP_000753589.1.81104 WP_000753589.1.81120 WP_000753589.1.81141 WP_000753589.1.81160 WP_000753589.1.81165 WP_000753589.1.8118 WP_000753589.1.81182 WP_000753589.1.81267 WP_000753589.1.81273 WP_000753589.1.81283 WP_000753589.1.81316 WP_000753589.1.81347 WP_000753589.1.81376 WP_000753589.1.81391 WP_000753589.1.81396 WP_000753589.1.81418 WP_000753589.1.81420 WP_000753589.1.81423 WP_000753589.1.81438 WP_000753589.1.81442 WP_000753589.1.81475 WP_000753589.1.81484 WP_000753589.1.81514 WP_000753589.1.81517 WP_000753589.1.81580 WP_000753589.1.81588 WP_000753589.1.81754 WP_000753589.1.81761 WP_000753589.1.81821 WP_000753589.1.81843 WP_000753589.1.81869 WP_000753589.1.81873 WP_000753589.1.81934 WP_000753589.1.81972 WP_000753589.1.81975 WP_000753589.1.82008 WP_000753589.1.82010 WP_000753589.1.82057 WP_000753589.1.82059 WP_000753589.1.82062 WP_000753589.1.82106 WP_000753589.1.82123 WP_000753589.1.82137 WP_000753589.1.82166 WP_000753589.1.82217 WP_000753589.1.82239 WP_000753589.1.82240 WP_000753589.1.82242 WP_000753589.1.82296 WP_000753589.1.82378 WP_000753589.1.82485 WP_000753589.1.82499 WP_000753589.1.82514 WP_000753589.1.8255 WP_000753589.1.82572 WP_000753589.1.82589 WP_000753589.1.82594 WP_000753589.1.82629 WP_000753589.1.82661 WP_000753589.1.8268 WP_000753589.1.82682 WP_000753589.1.82698 WP_000753589.1.82711 WP_000753589.1.82747 WP_000753589.1.8277 WP_000753589.1.82797 WP_000753589.1.82799 WP_000753589.1.82808 WP_000753589.1.82816 WP_000753589.1.82820 WP_000753589.1.82831 WP_000753589.1.82902 WP_000753589.1.82923 WP_000753589.1.83035 WP_000753589.1.83036 WP_000753589.1.83059 WP_000753589.1.8306 WP_000753589.1.83099 WP_000753589.1.83118 WP_000753589.1.83214 WP_000753589.1.83218 WP_000753589.1.83253 WP_000753589.1.83313 WP_000753589.1.83347 WP_000753589.1.83393 WP_000753589.1.83481 WP_000753589.1.83506 WP_000753589.1.83564 WP_000753589.1.83660 WP_000753589.1.83668 WP_000753589.1.83684 WP_000753589.1.83706 WP_000753589.1.83712 WP_000753589.1.83762 WP_000753589.1.83807 WP_000753589.1.8384 WP_000753589.1.8386 WP_000753589.1.83936 WP_000753589.1.83947 WP_000753589.1.84021 WP_000753589.1.84060 WP_000753589.1.84140 WP_000753589.1.84172 WP_000753589.1.84197 WP_000753589.1.84215 WP_000753589.1.84219 WP_000753589.1.84221 WP_000753589.1.84264 WP_000753589.1.84312 WP_000753589.1.84313 WP_000753589.1.84316 WP_000753589.1.84319 WP_000753589.1.84326 WP_000753589.1.84348 WP_000753589.1.84436 WP_000753589.1.84464 WP_000753589.1.8447 WP_000753589.1.84473 WP_000753589.1.84482 WP_000753589.1.84484 WP_000753589.1.84531 WP_000753589.1.84635 WP_000753589.1.84639 WP_000753589.1.84656 WP_000753589.1.84657 WP_000753589.1.84668 WP_000753589.1.84731 WP_000753589.1.8477 WP_000753589.1.84850 WP_000753589.1.84881 WP_000753589.1.84894 WP_000753589.1.84941 WP_000753589.1.85011 WP_000753589.1.85048 WP_000753589.1.85085 WP_000753589.1.85098 WP_000753589.1.85106 WP_000753589.1.85112 WP_000753589.1.85138 WP_000753589.1.85155 WP_000753589.1.85175 WP_000753589.1.85188 WP_000753589.1.85241 WP_000753589.1.85253 WP_000753589.1.8530 WP_000753589.1.85329 WP_000753589.1.85335 WP_000753589.1.85342 WP_000753589.1.85361 WP_000753589.1.85504 WP_000753589.1.85554 WP_000753589.1.85556 WP_000753589.1.85558 WP_000753589.1.85623 WP_000753589.1.8564 WP_000753589.1.85657 WP_000753589.1.85722 WP_000753589.1.85762 WP_000753589.1.85772 WP_000753589.1.85781 WP_000753589.1.85939 WP_000753589.1.85944 WP_000753589.1.86035 WP_000753589.1.86105 WP_000753589.1.86115 WP_000753589.1.86149 WP_000753589.1.86171 WP_000753589.1.86176 WP_000753589.1.86181 WP_000753589.1.86210 WP_000753589.1.86225 WP_000753589.1.86255 WP_000753589.1.86263 WP_000753589.1.86266 WP_000753589.1.86283 WP_000753589.1.86307 WP_000753589.1.86340 WP_000753589.1.86353 WP_000753589.1.86355 WP_000753589.1.86364 WP_000753589.1.86371 WP_000753589.1.86376 WP_000753589.1.86393 WP_000753589.1.86411 WP_000753589.1.86437 WP_000753589.1.86451 WP_000753589.1.86492 WP_000753589.1.86574 WP_000753589.1.86586 WP_000753589.1.86598 WP_000753589.1.86617 WP_000753589.1.86627 WP_000753589.1.86640 WP_000753589.1.86673 WP_000753589.1.86674 WP_000753589.1.86681 WP_000753589.1.86727 WP_000753589.1.86788 WP_000753589.1.8679 WP_000753589.1.86833 WP_000753589.1.8687 WP_000753589.1.86956 WP_000753589.1.86994 WP_000753589.1.87043 WP_000753589.1.8705 WP_000753589.1.87067 WP_000753589.1.87075 WP_000753589.1.87076 WP_000753589.1.87109 WP_000753589.1.8711 WP_000753589.1.87147 WP_000753589.1.87247 WP_000753589.1.87249 WP_000753589.1.87254 WP_000753589.1.87310 WP_000753589.1.87358 WP_000753589.1.87371 WP_000753589.1.87382 WP_000753589.1.87400 WP_000753589.1.87465 WP_000753589.1.87504 WP_000753589.1.87557 WP_000753589.1.87568 WP_000753589.1.87590 WP_000753589.1.87607 WP_000753589.1.87616 WP_000753589.1.87635 WP_000753589.1.87728 WP_000753589.1.8778 WP_000753589.1.87788 WP_000753589.1.87973 WP_000753589.1.88020 WP_000753589.1.8807 WP_000753589.1.88088 WP_000753589.1.88119 WP_000753589.1.88197 WP_000753589.1.8822 WP_000753589.1.88238 WP_000753589.1.88252 WP_000753589.1.88260 WP_000753589.1.88285 WP_000753589.1.88336 WP_000753589.1.88376 WP_000753589.1.88379 WP_000753589.1.88384 WP_000753589.1.8843 WP_000753589.1.88462 WP_000753589.1.88499 WP_000753589.1.88505 WP_000753589.1.88524 WP_000753589.1.88527 WP_000753589.1.88528 WP_000753589.1.88535 WP_000753589.1.88539 WP_000753589.1.8855 WP_000753589.1.88562 WP_000753589.1.88598 WP_000753589.1.88631 WP_000753589.1.88646 WP_000753589.1.88709 WP_000753589.1.88732 WP_000753589.1.88752 WP_000753589.1.88759 WP_000753589.1.88803 WP_000753589.1.88883 WP_000753589.1.88891 WP_000753589.1.88941 WP_000753589.1.88953 WP_000753589.1.88997 WP_000753589.1.89050 WP_000753589.1.8906 WP_000753589.1.89067 WP_000753589.1.89163 WP_000753589.1.89183 WP_000753589.1.89197 WP_000753589.1.89203 WP_000753589.1.89214 WP_000753589.1.89255 WP_000753589.1.8928 WP_000753589.1.89312 WP_000753589.1.89322 WP_000753589.1.89335 WP_000753589.1.89351 WP_000753589.1.8938 WP_000753589.1.89385 WP_000753589.1.894 WP_000753589.1.89405 WP_000753589.1.89427 WP_000753589.1.89432 WP_000753589.1.8945 WP_000753589.1.89455 WP_000753589.1.89466 WP_000753589.1.89474 WP_000753589.1.89479 WP_000753589.1.89492 WP_000753589.1.89551 WP_000753589.1.89569 WP_000753589.1.89583 WP_000753589.1.89601 WP_000753589.1.89627 WP_000753589.1.89646 WP_000753589.1.89710 WP_000753589.1.89747 WP_000753589.1.89781 WP_000753589.1.89818 WP_000753589.1.89839 WP_000753589.1.89852 WP_000753589.1.89879 WP_000753589.1.89917 WP_000753589.1.89959 WP_000753589.1.89988 WP_000753589.1.90022 WP_000753589.1.90050 WP_000753589.1.90063 WP_000753589.1.9009 WP_000753589.1.90139 WP_000753589.1.90156 WP_000753589.1.90219 WP_000753589.1.90257 WP_000753589.1.90266 WP_000753589.1.90270 WP_000753589.1.90332 WP_000753589.1.90342 WP_000753589.1.90349 WP_000753589.1.90405 WP_000753589.1.90435 WP_000753589.1.90441 WP_000753589.1.90467 WP_000753589.1.9059 WP_000753589.1.90591 WP_000753589.1.90602 WP_000753589.1.90626 WP_000753589.1.90706 WP_000753589.1.9081 WP_000753589.1.90822 WP_000753589.1.90834 WP_000753589.1.90837 WP_000753589.1.90844 WP_000753589.1.90848 WP_000753589.1.90856 WP_000753589.1.90864 WP_000753589.1.90873 WP_000753589.1.909 WP_000753589.1.90967 WP_000753589.1.9098 WP_000753589.1.90988 WP_000753589.1.90997 WP_000753589.1.91007 WP_000753589.1.9104 WP_000753589.1.91072 WP_000753589.1.91088 WP_000753589.1.91094 WP_000753589.1.91113 WP_000753589.1.91143 WP_000753589.1.91153 WP_000753589.1.9119 WP_000753589.1.91220 WP_000753589.1.91266 WP_000753589.1.91268 WP_000753589.1.91288 WP_000753589.1.91290 WP_000753589.1.91354 WP_000753589.1.91356 WP_000753589.1.91361 WP_000753589.1.91384 WP_000753589.1.91397 WP_000753589.1.91414 WP_000753589.1.91425 WP_000753589.1.91482 WP_000753589.1.91485 WP_000753589.1.91515 WP_000753589.1.91516 WP_000753589.1.91543 WP_000753589.1.91548 WP_000753589.1.91549 WP_000753589.1.91565 WP_000753589.1.9157 WP_000753589.1.91596 WP_000753589.1.9160 WP_000753589.1.91626 WP_000753589.1.91643 WP_000753589.1.91644 WP_000753589.1.91651 WP_000753589.1.91666 WP_000753589.1.9168 WP_000753589.1.91685 WP_000753589.1.91782 WP_000753589.1.91787 WP_000753589.1.91801 WP_000753589.1.91814 WP_000753589.1.91863 WP_000753589.1.91871 WP_000753589.1.91887 WP_000753589.1.91959 WP_000753589.1.91965 WP_000753589.1.91971 WP_000753589.1.92014 WP_000753589.1.92048 WP_000753589.1.92053 WP_000753589.1.92058 WP_000753589.1.92096 WP_000753589.1.921 WP_000753589.1.92163 WP_000753589.1.92201 WP_000753589.1.92215 WP_000753589.1.92276 WP_000753589.1.92304 WP_000753589.1.92311 WP_000753589.1.92384 WP_000753589.1.92403 WP_000753589.1.92434 WP_000753589.1.92532 WP_000753589.1.9255 WP_000753589.1.92577 WP_000753589.1.92634 WP_000753589.1.92648 WP_000753589.1.9266 WP_000753589.1.92693 WP_000753589.1.92780 WP_000753589.1.92781 WP_000753589.1.92819 WP_000753589.1.92882 WP_000753589.1.92886 WP_000753589.1.93016 WP_000753589.1.93017 WP_000753589.1.93027 WP_000753589.1.93033 WP_000753589.1.93052 WP_000753589.1.93069 WP_000753589.1.93072 WP_000753589.1.93100 WP_000753589.1.93138 WP_000753589.1.93167 WP_000753589.1.93185 WP_000753589.1.93252 WP_000753589.1.9331 WP_000753589.1.93338 WP_000753589.1.93379 WP_000753589.1.93388 WP_000753589.1.93427 WP_000753589.1.93428 WP_000753589.1.93464 WP_000753589.1.93509 WP_000753589.1.93531 WP_000753589.1.93533 WP_000753589.1.9356 WP_000753589.1.93569 WP_000753589.1.93601 WP_000753589.1.93626 WP_000753589.1.93630 WP_000753589.1.93665 WP_000753589.1.93670 WP_000753589.1.93694 WP_000753589.1.93695 WP_000753589.1.93716 WP_000753589.1.93733 WP_000753589.1.93743 WP_000753589.1.93800 WP_000753589.1.93821 WP_000753589.1.93873 WP_000753589.1.93877 WP_000753589.1.93918 WP_000753589.1.93922 WP_000753589.1.93951 WP_000753589.1.94008 WP_000753589.1.94028 WP_000753589.1.9420 WP_000753589.1.94213 WP_000753589.1.94232 WP_000753589.1.9426 WP_000753589.1.94282 WP_000753589.1.94298 WP_000753589.1.94302 WP_000753589.1.94343 WP_000753589.1.94353 WP_000753589.1.94404 WP_000753589.1.94417 WP_000753589.1.94430 WP_000753589.1.94446 WP_000753589.1.94468 WP_000753589.1.94475 WP_000753589.1.94507 WP_000753589.1.94544 WP_000753589.1.94580 WP_000753589.1.94589 WP_000753589.1.94676 WP_000753589.1.94704 WP_000753589.1.94739 WP_000753589.1.94790 WP_000753589.1.94806 WP_000753589.1.94808 WP_000753589.1.94822 WP_000753589.1.94823 WP_000753589.1.94836 WP_000753589.1.94841 WP_000753589.1.94847 WP_000753589.1.94880 WP_000753589.1.94889 WP_000753589.1.94892 WP_000753589.1.94927 WP_000753589.1.94955 WP_000753589.1.94991 WP_000753589.1.94997 WP_000753589.1.95005 WP_000753589.1.95011 WP_000753589.1.95022 WP_000753589.1.95028 WP_000753589.1.95035 WP_000753589.1.95062 WP_000753589.1.95105 WP_000753589.1.95129 WP_000753589.1.9513 WP_000753589.1.95161 WP_000753589.1.95243 WP_000753589.1.95310 WP_000753589.1.95329 WP_000753589.1.95366 WP_000753589.1.95378 WP_000753589.1.95381 WP_000753589.1.95390 WP_000753589.1.95400 WP_000753589.1.95428 WP_000753589.1.95521 WP_000753589.1.95563 WP_000753589.1.95604 WP_000753589.1.95634 WP_000753589.1.95655 WP_000753589.1.9566 WP_000753589.1.95666 WP_000753589.1.95771 WP_000753589.1.95783 WP_000753589.1.95800 WP_000753589.1.95824 WP_000753589.1.95834 WP_000753589.1.95858 WP_000753589.1.95929 WP_000753589.1.95951 WP_000753589.1.96053 WP_000753589.1.96059 WP_000753589.1.96066 WP_000753589.1.96086 WP_000753589.1.96110 WP_000753589.1.96114 WP_000753589.1.96145 WP_000753589.1.9616 WP_000753589.1.96177 WP_000753589.1.96222 WP_000753589.1.96223 WP_000753589.1.96247 WP_000753589.1.96253 WP_000753589.1.96341 WP_000753589.1.96425 WP_000753589.1.96450 WP_000753589.1.96457 WP_000753589.1.96478 WP_000753589.1.96480 WP_000753589.1.96494 WP_000753589.1.965 WP_000753589.1.96519 WP_000753589.1.96585 WP_000753589.1.9661 WP_000753589.1.96633 WP_000753589.1.96676 WP_000753589.1.9668 WP_000753589.1.9671 WP_000753589.1.96725 WP_000753589.1.96743 WP_000753589.1.96759 WP_000753589.1.96796 WP_000753589.1.96797 WP_000753589.1.96817 WP_000753589.1.96820 WP_000753589.1.96894 WP_000753589.1.9690 WP_000753589.1.9691 WP_000753589.1.96924 WP_000753589.1.96936 WP_000753589.1.96944 WP_000753589.1.96971 WP_000753589.1.97049 WP_000753589.1.97059 WP_000753589.1.97147 WP_000753589.1.97193 WP_000753589.1.97200 WP_000753589.1.97226 WP_000753589.1.97248 WP_000753589.1.97282 WP_000753589.1.9729 WP_000753589.1.97344 WP_000753589.1.97356 WP_000753589.1.97361 WP_000753589.1.97379 WP_000753589.1.9740 WP_000753589.1.97402 WP_000753589.1.97421 WP_000753589.1.97434 WP_000753589.1.97459 WP_000753589.1.97464 WP_000753589.1.97513 WP_000753589.1.97525 WP_000753589.1.97544 WP_000753589.1.97549 WP_000753589.1.97571 WP_000753589.1.97632 WP_000753589.1.97654 WP_000753589.1.9770 WP_000753589.1.97705 WP_000753589.1.97778 WP_000753589.1.97789 WP_000753589.1.97822 WP_000753589.1.97823 WP_000753589.1.97871 WP_000753589.1.97890 WP_000753589.1.97919 WP_000753589.1.97932 WP_000753589.1.97937 WP_000753589.1.98000 WP_000753589.1.98026 WP_000753589.1.98046 WP_000753589.1.98082 WP_000753589.1.98083 WP_000753589.1.981 WP_000753589.1.98139 WP_000753589.1.98155 WP_000753589.1.9816 WP_000753589.1.98167 WP_000753589.1.9817 WP_000753589.1.98176 WP_000753589.1.98187 WP_000753589.1.98205 WP_000753589.1.98232 WP_000753589.1.98239 WP_000753589.1.98279 WP_000753589.1.98292 WP_000753589.1.98301 WP_000753589.1.98312 WP_000753589.1.98357 WP_000753589.1.98384 WP_000753589.1.98400 WP_000753589.1.98429 WP_000753589.1.98451 WP_000753589.1.98466 WP_000753589.1.98543 WP_000753589.1.98549 WP_000753589.1.98569 WP_000753589.1.98633 WP_000753589.1.98654 WP_000753589.1.98665 WP_000753589.1.98702 WP_000753589.1.98727 WP_000753589.1.98757 WP_000753589.1.98775 WP_000753589.1.98784 WP_000753589.1.9883 WP_000753589.1.98875 WP_000753589.1.98920 WP_000753589.1.98988 WP_000753589.1.99006 WP_000753589.1.99029 WP_000753589.1.99046 WP_000753589.1.99101 WP_000753589.1.99168 WP_000753589.1.99182 WP_000753589.1.99234 WP_000753589.1.99246 WP_000753589.1.99289 WP_000753589.1.99295 WP_000753589.1.9930 WP_000753589.1.99302 WP_000753589.1.99304 WP_000753589.1.99307 WP_000753589.1.99334 WP_000753589.1.99345 WP_000753589.1.99401 WP_000753589.1.99471 WP_000753589.1.99475 WP_000753589.1.99486 WP_000753589.1.99487 WP_000753589.1.99498 WP_000753589.1.9950 WP_000753589.1.99501 WP_000753589.1.99511 WP_000753589.1.99549 WP_000753589.1.99592 WP_000753589.1.99619 WP_000753589.1.99632 WP_000753589.1.99666 WP_000753589.1.99692 WP_000753589.1.99698 WP_000753589.1.99804 WP_000753589.1.99827 WP_000753589.1.99869 WP_000753589.1.99892 WP_000753589.1.99986 YP_002409033.1.10275 YP_002415043.1.14968 YP_006781524.1.12065 gi|218701404|ref|YP_002409033.1| gi|218560968|ref|YP_002393881.1| gi|387885119|ref|YP_006315421.1| gi|218692183|ref|YP_002400395.1| gi|209398609|ref|YP_002273411.1| gi|386626803|ref|YP_006146531.1| gi|209921373|ref|YP_002295457.1| gi|387509341|ref|YP_006161597.1| gi|386606488|ref|YP_006112788.1| gi|556553730|ref|YP_008724268.1| gi|218707524|ref|YP_002415043.1| gi|407484374|ref|YP_006781524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]