SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478693498|ref|YP_007750405.1| from Rickettsia prowazekii str. Breinl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478693498|ref|YP_007750405.1|
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-57
Family Cystathionine synthase-like 0.000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478693498|ref|YP_007750405.1|
Sequence length 255
Comment NFS1 nitrogen fixation 1 isoform CRA_b [Rickettsia prowazekii str. Breinl]
Sequence
MAVNNEIGVIQPLKEIGKICRERNVFFHSDIAQGFGKIPINVNECNIDLASISGHKIYGP
KGIGALYIRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGIASEIAYNEMEKDTQHV
NYLFDRFLNNIHSKISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACT
SASLEPSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLVCSKIDKLRRLSPLWEM
MQEGVDLKKIRWTAH
Download sequence
Identical sequences gi|478693012|ref|YP_007749920.1| gi|478693498|ref|YP_007750405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]