SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478693912|ref|YP_007750819.1| from Rickettsia prowazekii str. Breinl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478693912|ref|YP_007750819.1|
Domain Number 1 Region: 14-410
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.35e-110
Family AAT-like 0.000000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478693912|ref|YP_007750819.1|
Sequence length 412
Comment hypothetical protein H375_5400 [Rickettsia prowazekii str. Breinl]
Sequence
MNNIKNLLIRAQIMSIISTRLNSIKPSPTLAVVKKTLELKKAGVNIIALGAGEPDFDTPD
NIKEVAITSIKDGFTKYTNVDGIPLLKQAIKNKFKRENNIDYELDEIIVSTGGKQVIYNL
FMASLDKGDEVIIPVPYWVSYPDMVALSTGTPVFVNCGIENNFKLSVEALEHSITDKTKW
LIINSPSNPTGAGYNCKELENIAKTLRKYPNVNIMSDDIYEHITFDDFKFYTLAQIAPDL
KERIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQMAAIEALNGT
QDYIKSNALNFQKKRDLALSILEEVTYFECYKPEGAFYLFVKCDKIFGTKTKSGRIIANS
NNFSEYLLEEAKVAVVPGIAFGLDGYFRISYATSMQELEEACIRIKHACNAL
Download sequence
Identical sequences gi|15603969|ref|NP_220484.1| gi|478692500|ref|YP_007749408.1| 272947.RP091 NP_220484.1.81248 WP_004599737.1.19079 WP_004599737.1.38548 WP_004599737.1.39958 WP_004599737.1.6643 WP_004599737.1.75108 WP_004599737.1.82014 WP_004599737.1.8209 WP_004599737.1.9355 WP_004599737.1.96644 gi|478693912|ref|YP_007750819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]