SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478694049|ref|YP_007750956.1| from Rickettsia prowazekii str. Breinl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478694049|ref|YP_007750956.1|
Domain Number 1 Region: 3-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.11e-99
Family GABA-aminotransferase-like 0.0000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478694049|ref|YP_007750956.1|
Sequence length 414
Comment 5-aminolevulinate synthase [Rickettsia prowazekii str. Breinl]
Sequence
MSYYDTIFNKHIDKIKSEGRYREFKSLKRQADNFPFAEYEDKQIVMWCINDYLGMSKHVK
VMQASIDALLKYGVGSGGTRNIGGNNISILELEKELADLHSKETALVFTSGFVANDTTLA
SLAKIIPDIVFFSDELNHASIIAGIKSSRAEKYVYRHLDVQHLEKLLQSVDINKPKIIVF
ESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVGLYGKQGGGISELLDCSNQIDIIQG
TLAKAYGTIGGYITSNYNLIDAIRLTAPGFIFTTSLPPVISTAATHSIRHLKESNEERIK
HQEVVTKLKNSFEHFNIPYLKNESHIIPIIIGDPIKATKVSNMLLNEYGIYVQHINFPTV
PRGTERLRIIPTPAHTDKMINDLSTALVHIFDELDIELSSAKELNKEVRLHLIA
Download sequence
Identical sequences D5AYC8 Q9ZCB8
gi|15604671|ref|NP_221189.1| NP_221189.1.81248 WP_004596804.1.19079 WP_004596804.1.38548 WP_004596804.1.39958 WP_004596804.1.61965 WP_004596804.1.6643 WP_004596804.1.75108 WP_004596804.1.80123 WP_004596804.1.82014 WP_004596804.1.8209 WP_004596804.1.96644 272947.RP841 gi|478694049|ref|YP_007750956.1| gi|478692634|ref|YP_007749542.1| gi|383489918|ref|YP_005407595.1| gi|383500056|ref|YP_005413417.1| gi|383489079|ref|YP_005406757.1| gi|383500891|ref|YP_005414251.1| gi|383488234|ref|YP_005405913.1| gi|383486818|ref|YP_005404498.1| gi|386082736|ref|YP_005999315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]