SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478694154|ref|YP_007751061.1| from Rickettsia prowazekii str. Breinl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478694154|ref|YP_007751061.1|
Domain Number 1 Region: 3-419
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.23e-177
Family GABA-aminotransferase-like 0.00000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478694154|ref|YP_007751061.1|
Sequence length 420
Comment hydrolase [Rickettsia prowazekii str. Breinl]
Sequence
MNILNNNLYEMDKEIYEIIKNEKIRQNNVIELIASENFVSSAVLEAQGSILTNKYAEGYP
SKRFYNGCDEVDKAEVLAIERIKKLFNCKYANVQPHSGSQANQTVYLALLQPCDTILGMS
LDSGGHLTHGAAPNISGKWFNTVSYHVDQETYLIDYDEVERLAVLHNPKLLIAGFSAYPR
KIDFAKFRKIADKVGAYLMADIAHIAGLVATGEHQSPIPYAHVVTSTTHKTLRGPRGGLI
LSDDEEIGKKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKNYIKQVISNAKALAIS
LQERGYDILTGGTDNHIVLVDLRKDGITGKCAANSLDRAGITCNKNAIPFDTTSPFITSG
IRFGTPACTTKGFKEKDFVLIGHMVAEILDGLKHNEDNSKTEQKVLSEVKKLMKLFPFYD
Download sequence
Identical sequences D5AY10 O08370
gi|15604577|ref|NP_221095.1| gi|478694154|ref|YP_007751061.1| NP_221095.1.81248 WP_004597016.1.19079 WP_004597016.1.38548 WP_004597016.1.39958 WP_004597016.1.61965 WP_004597016.1.6643 WP_004597016.1.75108 WP_004597016.1.80123 WP_004597016.1.82014 WP_004597016.1.8209 WP_004597016.1.9355 WP_004597016.1.96644 gi|383488138|ref|YP_005405817.1| gi|383486724|ref|YP_005404404.1| gi|478692739|ref|YP_007749647.1| gi|383489823|ref|YP_005407500.1| gi|386082618|ref|YP_005999197.1| gi|383488983|ref|YP_005406661.1| RiprA.00008.a gi|383500796|ref|YP_005414156.1| 272947.RP743 gi|383499962|ref|YP_005413323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]