SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327310088|ref|YP_004336985.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310088|ref|YP_004336985.1|
Domain Number 1 Region: 4-378
Classification Level Classification E-value
Superfamily L-aspartase-like 1.73e-99
Family L-aspartase/fumarase 0.0000000000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327310088|ref|YP_004336985.1|
Sequence length 407
Comment adenylosuccinate lyase [Thermoproteus uzoniensis 768-20]
Sequence
MEPISPFDWRYGSEELRRLFSRQSIVDAYLEVERALVCALEELGVAERGCCEAASRASIS
AEEVYRLERELRHDVLALVQLLEERSGCRFVHYGATSNDVIDTAWALLIRRALGAIKERG
RAVAEELRRLALKYADLPAVGRTHGQWAEPITLGFKFANYYYELYIACRALYAAEEHVRG
KLGGAVGTMASWGPLGLKLREAVSRRLGVPFHPISTQVAPRESFAFLASALALLAGFAER
LATEVRELSRPEIGEVFETVGGGSSAMPHKANPTNSERVVSLARYVRSLLVVAHENIALW
HERDLTNSANERVWIPEALLAVDEILATTARVLRTLHVDEERVRRNLEAALPQITSEFRM
LELVRKGMRRAEAYRAARAEGGSGELPRGWPVRELIDSALALEACPQ
Download sequence
Identical sequences F2L1K3
WP_013679009.1.87035 gi|327310088|ref|YP_004336985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]