SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327310327|ref|YP_004337224.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310327|ref|YP_004337224.1|
Domain Number 1 Region: 161-339
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.99e-16
Family Bacterial dinuclear zinc exopeptidases 0.0091
Further Details:      
 
Domain Number 2 Region: 47-131
Classification Level Classification E-value
Superfamily PA domain 0.0000445
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327310327|ref|YP_004337224.1|
Sequence length 438
Comment hypothetical protein TUZN_0416 [Thermoproteus uzoniensis 768-20]
Sequence
MGDLARKCMEYRDLAAGSPEERDFLGFIASILDIPNIWLHFSPVEVLYWRDRGSSIEVDG
KRYQILAMPYSRPGTYEGRLVELDGDVEGNIALAPFPQDVNDAKYLLIKAARRGASALVL
YGDPLRRIVVTDEFGFKYDAAPPPISAASAPSEIGRALGKRASLDIDVEAKTAFSYNVIA
MNSFEDTPMISAHYDHWLAGAADNCGGVEAAIMAFLELVAEDYPIALGLFTAEEGVGPHV
PSLYWAWGSLAYFSRWRPKLLINLDVIGRGSPKAYVMPYMEETVRGLLPVDRPHADFDSL
HYETAGLPAVTISSLEDIWNVYHSPLDDDVDDAAVGFAAEIAKRLARVESKPPRIDLLQY
GVRARPDPYDAWSVAYNYLVVFKDFNHSDIIYVNVFDFLRREAANYARIDLLGGPTLCVG
DCDRALDVYRELASLKLT
Download sequence
Identical sequences F2L2X4
gi|327310327|ref|YP_004337224.1| WP_013679248.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]