SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327310553|ref|YP_004337450.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310553|ref|YP_004337450.1|
Domain Number 1 Region: 208-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.89e-71
Family Leukotriene A4 hydrolase catalytic domain 0.00038
Further Details:      
 
Domain Number 2 Region: 23-199
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 9.02e-37
Family Leukotriene A4 hydrolase N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 537-724
Classification Level Classification E-value
Superfamily ARM repeat 9.87e-30
Family PBS lyase HEAT-like repeat 0.057
Further Details:      
 
Domain Number 4 Region: 707-789
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000144
Family PBS lyase HEAT-like repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327310553|ref|YP_004337450.1|
Sequence length 823
Comment peptidase M1, membrane alanine aminopeptidase [Thermoproteus uzoniensis 768-20]
Sequence
MTRYLLGRDFAFPEYVPRFPRQYDFDVLKLDADIEVDLWSREVKGVVKYRVRAKRDLRKV
MLDAVELEVLGASTSYSYDGETITLDLDLPAGREAEFEIRYRARPRKGIYFVLPDKHHPY
RVPMAWTQGESEDNRYWLPLPDTPNIKFPWKLAITVPKPYVAGSNGVLVEVRDNGDRQTF
VWEMRHPMSPYLIALAAGDFEIIRDKCGDVALEYWLPRGRAGAAQYSFKNTCNIMKFFEE
YLGVPYPYERYAQVVVQEFVYGGMENTTFTILTDWTLHDRHAHCPYGDFPCAEEDFSSDP
LVAHEMAHQWFGDLVTAKDWGHISINESFATFIEALWTERSKGRDEYLYEIYLNLKTYLN
EYSTRYARPIVTNLYAIPEEVFDRHSYEKGSVVLHMIRSLLGDDAFRRGLKLFLERHRYK
NADIEDLRKALEEASGRDLEWLWRQFFYSAGHPVVKASWNKNNGVRVVLEQTQPDDSFPV
YTLPLEIDVVYEDGRRDRIAVSFSEKRLEVPLGEKPRYVCVDPEFKLLKVVELSFPVEVL
GAMLEDEHLYCRLQAVEALRKNGSNRAVELLAKALRDRFWGVAAEAARALGAIGTADAVK
ALMEAYREVRHPRARRAVMEALGNARRREAAEFLDKVLHDGSESYYVRYEAARALGRIKW
EFAEHSLKRALEYGGHLDVVTRGAIEGLAELGSDNALDIVLRYAAEDKPTWVRMTAVQSL
SKFGPRPQVLEALRRALRDENYRIRAAAVTAALDLMDARLLPDLQERAERDVDGRIRRMA
REAAEKIRKAMDRGAEYQRLREEVEKLRDEYRKLLDRLARLER
Download sequence
Identical sequences F2L482
gi|327310553|ref|YP_004337450.1| WP_013679474.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]