SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327310707|ref|YP_004337604.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310707|ref|YP_004337604.1|
Domain Number 1 Region: 12-401
Classification Level Classification E-value
Superfamily L-aspartase-like 2.2e-87
Family L-aspartase/fumarase 0.00000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327310707|ref|YP_004337604.1|
Sequence length 425
Comment argininosuccinate lyase [Thermoproteus uzoniensis 768-20]
Sequence
MALYRRWIGGSSDVVAGYTSSIQDDAEIAREVVEVMKAHAAHLAEAGLVPRGDGEAVLAA
LGEVRVEDLLRPGYEDVHEALEDYLIKKVGPAGGWVGLGRSRNDHVAAAIRLRLLRHMDN
LSREVKGLMCVAARRAAEYADCVMPSFTHFQPAQPITFGHYLLALYELLSDLLSALSAVR
PIVDKSPLGSGPSGGTSAPLDRKRLAQLAGFGGVVENTLYASSSRFFASLAASVVASALA
ELSRFVDDLVAWSSPLLGYVEPPAEHVSTSSIMPHKRNPVTLEVLRARISEAVADASALL
AVQEKIGYGYSLDLQEATRHLWRVFKTAEEGVAVLRSFLEGMRFNCDKAYQDAKRYPTTS
SDAAERLALGGVPFREAYFKTAEAVKAGSADLPDPREAVRRPVLGSPDPERVRNSAKEKL
SICQQ
Download sequence
Identical sequences F2L543
gi|327310707|ref|YP_004337604.1| WP_013679628.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]