SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327310833|ref|YP_004337730.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310833|ref|YP_004337730.1|
Domain Number 1 Region: 261-337
Classification Level Classification E-value
Superfamily E set domains 0.0000394
Family Filamin repeat (rod domain) 0.036
Further Details:      
 
Weak hits

Sequence:  gi|327310833|ref|YP_004337730.1|
Domain Number - Region: 157-217
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00314
Family Transglutaminase, two C-terminal domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327310833|ref|YP_004337730.1|
Sequence length 800
Comment peptidase C14, caspase catalytic subunit p20 [Thermoproteus uzoniensis 768-20]
Sequence
MRAGLVALVVLLLISLVVNAQQITTLGIRVSMPAPLPSQQFPAAIVDFTGMVRHELYLND
MFYITFDLTQYQGTYFVVIKQIGGPGSPAEVAYGDVQGGYIYGYPMEIVQPIYEGQTYTF
EIDLYNQNGAFVGSATVSYVEKWCPDVTIDGVQLTPSTPVGGGNVQVAVTLTNDGEESWR
YHVSVYSQGGALTKTSQDVTIGAGSTTTVTLTVPVSATYTATTDTMVVDVSCDNGAWHFT
RSYQINIMPARPGPFVISAPTVQARLGQPVTFTLSLTNQGSDAQPISLTFSTGSASFNLP
STLPGGTTTNVPVTFTPTMPGVYKVTVTLTYKSPITGQTYQDTGSFTVEVYAELAVNAVD
QNGNPVQITPNIAGNNTSVAWLLPGTYTVSVPQIVDLGGGARLVFVGWQGGGTSPSTTVT
LNGNTQLTAVYKEQYQVVLDLSPALSSQTYWVDAGSSFTPQAPSHVDITQDSRWALEGFQ
VAGQQIGPGQAITVTGPLTIKAVWVKEYKITVSCGQVACINGQSQYVQWAQEGSTLSITL
AQIVNVNSRTRWVLSGSPTISFTVTGPQTITPNYVEEYYVNFGYAVKTASGISSTTVVTG
AWIESGNTVTIPTNQLEPPGGPGVKYVFSGYLVGNTPISGPQSGQTITVTGPVDVYAVWD
KYYYLNVTTPVGTAQGGGWYLADSYATVSVGQTTYGFLVYQRFVKWVASDGSVYTDPTIT
IKVDKPLTLTAVWAQDFTQAAILGGGLAAAGTAFWKRDFITRTLSRTFMKTRSKTRVELE
DVDKTHTWVAGEKKESNDNE
Download sequence
Identical sequences F2L5X3
gi|327310833|ref|YP_004337730.1| WP_013679754.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]