SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327311023|ref|YP_004337920.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|327311023|ref|YP_004337920.1|
Domain Number - Region: 54-86
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00627
Family Tetracyclin repressor-like, N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327311023|ref|YP_004337920.1|
Sequence length 147
Comment putative transcription regulator, encoded next to RecA superfamily ATPase [Thermoproteus uzoniensis 768-20]
Sequence
MTSLDVPLKPVGREEIRRLESALLVMALLDREALEAMKNPAERVTWVDSLYTAAAALARE
RAGVPVSRIAEELGVTEATVRRHLRGETKAGQLVAKVYERLAREGFKPELPPELGGVPDC
AGQVEELRSKLERVKKALGEILGLLRP
Download sequence
Identical sequences F2L0C6
gi|327311023|ref|YP_004337920.1| WP_013679944.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]