SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327311551|ref|YP_004338448.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327311551|ref|YP_004338448.1|
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Resolvase-like 1.01e-28
Family gamma,delta resolvase, catalytic domain 0.002
Further Details:      
 
Weak hits

Sequence:  gi|327311551|ref|YP_004338448.1|
Domain Number - Region: 209-246
Classification Level Classification E-value
Superfamily YfgJ-like 0.0128
Family YfgJ-like 0.012
Further Details:      
 
Domain Number - Region: 160-201
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0511
Family Paired domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327311551|ref|YP_004338448.1|
Sequence length 253
Comment Resolvase, N-terminal domain-containing protein, partial [Thermoproteus uzoniensis 768-20]
Sequence
MIPAVTYIRVSTEGQDPENQREYLEKWAPAHGLTILRHYVDVGVSGATEPWTRPAFRRLM
EEASSLEPRPKVLLVYEVSRLVRSFQELFQLLDVVENKMGLVVVSASEREQALQTVDGMY
RQFLRAVLAFVAAMEREFIRQRTKAALERAKAAGKISNVAERLPPEVVAKIVEMRAGGAS
LRDIGKAFGLSTYEVRRVLAAAGAYRPTEYSCPRCFSRLKVVERTAKIQNGMYRVVERLY
CPNCGYEELLEKA
Download sequence
Identical sequences F2L317
gi|327311551|ref|YP_004338448.1| WP_013680471.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]