SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327311741|ref|YP_004338638.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327311741|ref|YP_004338638.1|
Domain Number 1 Region: 6-43
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000179
Family Paired domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327311741|ref|YP_004338638.1|
Sequence length 145
Comment LuxR family regulatory protein [Thermoproteus uzoniensis 768-20]
Sequence
MKLTATEQRVVELYNSGLKPRDIANRLGISINTVYKALSKHRRIAETPGPEDGEQRLSYN
YYAVVMPMASSSVIYSFAPPQTPRVDDLEPLVKRLEYVLERLEKLLDGKQIVESKAAEAP
EPADGAPDFIRRNAWVKLLRGRSFQ
Download sequence
Identical sequences F2L414
WP_013680661.1.87035 gi|327311741|ref|YP_004338638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]