SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327311763|ref|YP_004338660.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327311763|ref|YP_004338660.1|
Domain Number 1 Region: 38-122,165-183,216-483
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.41e-55
Family AmyC N-terminal domain-like 0.05
Further Details:      
 
Weak hits

Sequence:  gi|327311763|ref|YP_004338660.1|
Domain Number - Region: 619-686
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0129
Family Starch-binding domain 0.042
Further Details:      
 
Domain Number - Region: 741-795
Classification Level Classification E-value
Superfamily E set domains 0.028
Family AMPK-beta glycogen binding domain-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327311763|ref|YP_004338660.1|
Sequence length 806
Comment glycoside hydrolase family protein [Thermoproteus uzoniensis 768-20]
Sequence
MNKKLILAVTVLLLLALASYGLAAVNGSSKAYTIHTRLYVVFLWHMHQPPYVLPNGMVLA
PWPRLWVTKGYYPMVALALAEHAHVTFDFTPTLLEQIEIVAQGKYDDPYLQASEADPYSL
SEAQKLFILERFFDVAPIQIERYPRYYCIYQEVKQNGIQWALQNFTPQDYLDLQTLFNLA
WYNVYILERDPQLRPIYLYALASNCTTHFTIQQRDLLLAGFQRYAERLLQLIEERGGGSG
SIEFVTTPMYYPIMPLVANLTSALQSNPYLIVPPTGFSYPQDVYRQLLEARTFYNQTFGF
VPRGLWPPEMAVSQEALELVAEAGFNYTYISGDTLALTLGRPPGVLNYALWYIPTEYGRL
YILARDDQISNYIGFGASGDVNSRGPLYAANKTYWMIKSVEYQLEQAGVKRGVVLIALDG
ENPFQYFKDDGVQYLTYLYGLIKSDRTMKMATTLEAVEALKSKALPLERPVVASTWAGDF
STWVGNWEQNLAWTILYNVRQDVANWTCMYEAEAGDWFFWYSGYFASATPYIFDDLFRAF
ARCAAARYNYTWPLDEPIYFSSNAQIGWAGSPFERIVTVEGPYTFSVQVWSPNYSPPNPA
DAQLIRAVLHFGPVNYFGGPWTYLYFVPMNFSGIYGNNYVYTATVDLKPGNYEFIYIVQG
SNTYYAHATSTADGNYWITVLPTPSGIVQSAYVYQVRVYGGGGYASYSPASAPGCVYAPA
GSTVGIVVAVQSSGTVYPVLHYGYGSWWWPVDDVLAKPVGTYGGYTLYEANITLPSSGVQ
YVFEIFQSGGVYWVNVNGANGQICAS
Download sequence
Identical sequences F2L4B6
gi|327311763|ref|YP_004338660.1| WP_013680683.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]